KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519956
Entry
107519956         CDS       T06036                                 

Gene name
CCL11
Definition
(RefSeq) eotaxin
  KO
K16597  C-C motif chemokine 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04062  Chemokine signaling pathway
ray04657  IL-17 signaling pathway
ray05310  Asthma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107519956 (CCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107519956 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107519956 (CCL11)
   04062 Chemokine signaling pathway
    107519956 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107519956 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107519956 (CCL11)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Chemokines
   107519956 (CCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107519956
NCBI-ProteinID: XP_016018711
LinkDB
Position
Unknown
AA seq 97 aa
MKVAAALLYLLLTVAVFNIQLLAQPALVPTICCFNLRNRKISIQQLHSYRRITSSRCPQK
AVLFKTKQAKEICAYPTKKWVQDAMKYLDQKSRTPKP
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaaggttgctgcagcccttctgtacctcctgctcacagtggcagtcttcaacatccag
ttgctggctcagccagctctcgttccgactatctgctgctttaatctgagaaataggaag
atctccattcagcaactgcacagctatagaagaataaccagcagcagatgtccccagaaa
gctgtgctcttcaagaccaaacaggccaaggagatctgtgcctatcctacgaaaaagtgg
gtccaggatgccatgaagtacctggaccaaaaatcccgaactccaaagccataa

DBGET integrated database retrieval system