KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519989
Entry
107519989         CDS       T06036                                 

Gene name
CCK
Definition
(RefSeq) cholecystokinin
  KO
K05226  cholecystokinin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04911  Insulin secretion
ray04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107519989 (CCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107519989 (CCK)
  09154 Digestive system
   04972 Pancreatic secretion
    107519989 (CCK)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 107519989
NCBI-ProteinID: XP_016018765
LinkDB
Position
Unknown
AA seq 115 aa
MNSGVCLCVLMAVLAAGALAQPVSPADLEGPGAQREKEAPRRQLRAVHRMDGEPRAHLGA
LLARYIQQARKAPSSRMSAMKNLQGLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaatagcggcgtgtgcttgtgcgtgctgatggccgtgctggctgctggcgccctggcg
cagcccgtgtctcccgcggacctcgagggccctggggcgcagcgggagaaggaggcgccc
cggaggcagctgagagcagtgcacaggatggacggcgagccccgagcgcacctgggcgcg
ctgctggccagatacatccagcaggcccggaaagctccttccagccgaatgtctgcgatg
aagaacctgcagggcctggaccccagccacaggataagcgaccgggactacatgggctgg
atggacttcgggaggcgcagcgcggaggagtacgagtacccctcgtag

DBGET integrated database retrieval system