KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520024
Entry
107520024         CDS       T06036                                 

Gene name
RYR2
Definition
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04911  Insulin secretion
ray04921  Oxytocin signaling pathway
ray04972  Pancreatic secretion
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107520024 (RYR2)
   04020 Calcium signaling pathway
    107520024 (RYR2)
   04024 cAMP signaling pathway
    107520024 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107520024 (RYR2)
   04921 Oxytocin signaling pathway
    107520024 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107520024 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    107520024 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    107520024 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107520024 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107520024 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    107520024 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107520024 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107520024 (RYR2)
   05414 Dilated cardiomyopathy
    107520024 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107520024 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107520024 (RYR2)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107520024 (RYR2)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107520024 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 107520024
NCBI-ProteinID: XP_016018848
LinkDB
Position
Unknown
AA seq 4942 aa
MAGTLVPESLLASLIREPPAVQRDDEVVLQCTATVHKEQQKLCLAAEGFGNRLCFLESTS
NSKNVPPDLSICTFVLEQSLSVRALQEMLANTMEKSEGKFMMKTAQGGGHRTLLYGHAIL
LRHSCSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGDGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGVVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDHNLLLVDKEKADVKSTAFTFRSSKEKLDAGVRKEVDGMGTSEIKYGDSV
CYIQHVNTGLWLTYQSVDVKSVRMGAIQRKAIMHHEGHMDDGINLSRSQHEESRTARVIR
STVFLFNRFIRGLDALGKKAKAPAADLPIESVSLSLRDLTGYLHPPDEQLEHEDRQNRLR
ALKNRQNLFQEEGMISLVLECIDRLHVYSSAAHFADVAGTEAGQAWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGFSPYPGGGEEGGGSGVGD
DLFSYGFDGLHLWAGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPKERLKVEHSREY
KQERAPARDLLGPTVALTQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEK
VKKMKLPKNYQLTSGYKPAPMDLTFIRLTQAQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYSLEAPDQDHAARAEAAGR
TGERFRIFRAEKTYAVRAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERAFTFDGL
KAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDTGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTVDSSPCLKVTQKSFGSQNSSTDITFYRLSMPIECAEVFSRTAAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKAEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPAS
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
GNNGLEIGCVVDAATGLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHRNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRVSERQGWLVQ
CAEPLQFMSLHIPEENRSVDILELTEQEELLRFHHHTLRLYSAVCALGNHRVAHALCSHV
DEPQLLYAIESKYMPGLLRAGYYDLLIDIHLSAYATARLRMTKSITLFPDAHKEHGLPGI
GLSTSLRPRMRFSSPSFVXINHDCYQDSPEFPLDTLKAKTMQMLTEAVREGGLRARDPVG
GTTEFLFVPLIKLFYTLLIMGVFHGEDLKHILQLIEPRVFTEATPEAECQARSXADDARP
EGMRGDAAEGLLQMKLPAVRSXMCLLLQYLCDCQVRHRIEAIVAFSDNFVAKLQDNQRFR
YNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDL
MAHCGIELGEDGSLDGSSDLTIKGRLLSLVEKVTYLKKKQTEKPVERDARKSSTLQQLIS
DTMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLIRALPKTYTINGVSVEDTINLLASL
GQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVA
AASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVCKGYPDIGWNPVEGERYLDFLR
FAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGAGLLAAMEEAIRIAEDPSRDGPS
PTSESAKTPDAEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSIL
RSLIPLGDLVGVISIAFQMPTVAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDF
LLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHAS
LIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHA
KMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFK
LALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINK
YAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTML
AWGWRVARTREGDSMALYSRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEM
MAENYHNIWAKKKKVELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQISGYAV
SRGFKDLELDTPSIEKRFAYSFLQQLIRYVDGAHQYILEFDGGSRGKGEHFPYEQEIKFF
AKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFG
NDATSIVNCLHILGQTLDARTVMKTGLESVRSALRAFLDSAAEDLEKTLENLRQGQFTHT
RSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTS
KSIYVERQRSALGECLAAVAGAFPVAFLETHLDKHNIYSVYNTKSSRERAALNLPASVED
VCPNIPSLEKLMGEIVEVAESGVRYTQMPHVMEVVLPLLCSYLSRWWEHGPESNPARAAT
CCTALSSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLM
EKLKKKAAMVVSEEEHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAK
WLKEPNPEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAA
VSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKSRLSMKDTEE
EVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDSSDPEKTVERVLDIANVLFHLEQ
VEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHY
FEDKLIEDLAKPGAEPAEDEDGARRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIM
AKSCHDEEEDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTVSAS
KGETGPMVAATLKLGIAILNGGNATVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNA
FERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTT
VNIIISTVDYLLRVQESVSDFYWFYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGP
CTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLE
GNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKRE
FHRVMESHKHYTQSETEFLLSCVETDENETLDYEGFVKRFHEPAKDIGFNVAVLLTNLSE
HMPNDTRLQTFLELAESVLNHFQPFLGRIEVMGSAKRIERVYFEISKSSRMQWEKPQVKE
SKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDSNERSASKEESEAEKPE
EQGPRMAFFSMLTVGAALLALRHNALTLLRMLSLKSLRKQVKKVKKMTVRDMAAALFCSY
WGVSLSLLHFAASVLRGFSRIVCSLLLGGSLVEGAKKIRVAELLANMPDPTQDEVRGDGE
EAERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMS
NPVPAPEVQDKCQEQKAKEEEKEEKEEKSEPEKAGGENGEKEEKAKEEKGKQKLRPLHTH
RYGEAEAPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSAV
EGRELPARSPGDSAAVGGLGGLGGGALRATAVHYVLEESSGYMEPALRILAVLHTAISFC
CIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYW
DKFVKRKVMDKYGDFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLSSVDVKY
QMWKLGVVFTDNSFLYLAWYMTMSVLGHFNNFFFAAHLLDIAMGFKTLRTILSSVTHNGK
QLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGG
GIGDEIEDPAGDEYEIYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQQEQVKEDME
TKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQ
ERCWEFFPAGDCFRKQYEDQLN
NT seq 14829 nt   +upstreamnt  +downstreamnt
atggcaggcaccctggtacctgaatccctgttggcatccctcatcagagagccacctgcc
gtccagcgcgatgacgaggtcgtcctgcagtgcacggccaccgtccacaaggagcagcag
aagctgtgtctggcggcggagggcttcggcaacaggctctgtttcttggagtccacttca
aattccaagaatgtacccccagacctctccatctgcacctttgtgctggaacagtctctc
tccgtccgggccctgcaagagatgctggcaaacacgatggagaagtcagaagggaaattc
atgatgaagactgctcagggcggcggccaccggacgctcctctacggacacgccattctg
ctgcgccattcctgcagcggcatgtatctgtgttgcctgtccacctcccggtcttccacg
gataaactggccttcgatgttggcttgcaagaagacacgacaggtgaggcctgttggtgg
accatccacccggcctcgaagcagcggtcggaaggggagaaagttcgagtgggagatgac
ctcatcttggtgagcgtgtcctccgaaaggtacttgcacctgtcctacggtgacggcagc
ttgcacgtggacgcagctttccagcagaccctgtggagcgtggcccccatcagctcaggg
agcgaagcagcccaagggtatctgatcggtggcgacgtcctcaggttgctgcacggacac
atggacgaatgcctcactgtcccttcgggagagcacggggaggagcagcggaggaccgtc
cattatgaaggtggcgttgtgtctgttcacgcgcggtccctgtggagactggagacgcta
agggtggcgtggagtggaagccacatccggtggggccagcctttccgactccgccatgtc
acgaccgggaaatacttgagtctcatggaggaccacaaccttctgctcgtggacaaagaa
aaagcagacgtgaaatcgacagcgtttaccttccggtcttccaaggaaaaattggatgca
ggggtgagaaaagaagtcgatggcatgggaacatccgagataaagtatggagactcagtg
tgctacatacaacacgtgaacacaggcctgtggctgacgtaccagtctgtggacgtgaaa
tctgtgaggatgggagccatacagcgtaaggctattatgcaccatgaaggccacatggat
gatggcataaatttatctagatctcagcatgaagaatcgcggacagcgcgagtcatccgg
agcaccgtcttcctttttaatagatttataaggggcctcgacgctcttggcaaaaaggcg
aaggcgcccgcagcggacttgcccatcgagtcggtcagcctgagtctgcgggacctgacg
ggctacctgcacccgcccgacgagcagctggagcacgaggaccggcagaaccggctgcgg
gccctgaagaaccggcagaacctcttccaggaggaggggatgatcagtctcgtgctcgag
tgcatagaccggctgcatgtctacagcagcgccgcccacttcgctgacgtggccgggaca
gaagccgggcaggcctggaagtcgatcctgaactctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgcgctcagttttctggctccctcgactggctgatcagc
cgattggaaaggctggaagcgtcttctggtattctcgaagttttgcactgtgtgttagta
gaaagtccagaagctctaaacattattaaagaaggacatattaaatccattatttcactt
ttagacaagcacggaagaaatcacaaggtcctggacgtcttgtgctctctctgcgtctgc
cacggagtggctgtccgctccaaccagcacctcatctgtgacaatctcctgccgggaaga
gatctcttgctgcagacccgcctcgtgaaccacgtcagcagcatgaggcccaatattttt
ctgggcgtgagcgaagggtctgcccagtataagaagtggtactacgaactgatggtggac
cacaccgagccgttcgtgacagccgaagcgactcacctgcgcgtgggctgggcgtccacg
gagggcttctcgccctaccccggaggcggcgaggaggggggcggcagcggcgtgggcgac
gacctcttctcctacgggttcgacggcctgcacctctgggcaggttgtattgctcggact
gtaagctcaccgaaccaacatctgttgagaactgatgatgtcatcagttgctgtttagac
ctaagtgccccgagcatctccttccgaattaacggacaacctgttcaaggcatgtttgag
aatttcaacatcgatggcctcttctttcctgttgttagtttctctgcgggaataaaggtg
cgctttctgcttggggggcgacatggagaattcaagttcctgcccccgccgggctacgct
ccgtgtcacgaagctgtcctgccgaaggagaggctgaaggtggagcacagccgcgagtac
aagcaggagagggcgcccgcgagggacctgctgggccccacagtggcgctgacgcaagcc
gccttcacgccggttcccgtggacaccagccagatcgtgttgccaccccacctggagagg
ataagagaaaaattggcagagaatatccatgagctctgggttatgaataagattgaactt
ggctggcagtatgggccggtgcgcgatgacaacaagaggcagcacccgtgtctggtggag
ttctccaagctgcccgagcaggagcgcaattacaacttacagatgtccctggagaccctg
aagactctgctggcattaggatgccacgtgggcatcgcagacgagcatgctgaagaaaag
gtgaagaagatgaagctgcccaagaactaccagctgacgagtggatacaaacctgccccg
atggacttgacctttatcagactcacccaggcccaggaggcaatggtggacaagttggcg
gaaaacgcccataacgtgtgggcccgggatcggatccggcagggctggacctacggcatc
cagcaggatgtaaagaacagaagaaaccctcgcctcgttccctacacacttctcgatgac
agaaccaagaaatccaataaggacagcctccgtgaggctgtgcgcacgctgctggggtac
ggctacagcctggaggcgccggatcaggatcacgctgcgcgcgccgaggcggccggccgc
accggggagaggttccgcatcttccgggccgagaagacgtacgcggtgcgggccgggcgg
tggtatttcgagttcgaggctgtcaccgccggggacatgcgtgttggctggagcaggccg
ggctgtcagccggaccaggagctgggctcggacgagcgcgccttcaccttcgatggcctc
aaggcccagcgatggcaccagggcaatgagcactatggccgctcttggcaagccggcgat
gttgtagggtgtatggttgacatgacagagcacaccatgatgttcacgctgaacggtgaa
atcctccttgatgattcgggctcagaactggcgttcaaggactttgacaccggcgatgga
ttcatacctgtgtgcagccttggggtggctcaagtgggcaggatgaacttcggaaaggac
gtgagcaccttgaaatatttcaccatctgtggcttacaggagggctacgaaccatttgcc
gttaacacaaacagggacattaccatgtggctgagcaagcggctgcctcagtttctccaa
gttccatcaaatcatgaacatattgaggtgaccaggatagacggcaccgtagacagttcc
ccgtgcttaaaggtcacgcagaagtcctttggttctcagaacagcagcacggacatcacg
ttttaccgcctgagcatgcccatcgagtgcgccgaggtcttctccaggacggcggctggg
gggctgcctggggccggcctctttgggcccaagaacgatctggaggattacgatgcggac
tctgacttcgaggttctgatgaagacagctcacggccacctggtgcccgatcgagtcgac
aaagacaaagaagctacgaaagcagagtttaataaccacaaagattacgcccaggagaag
ccctctcgcctgaaacagagatttttgctgagaagaacgaaaccagattacagcacaagc
cattctgcgaggctcacagaagacgtgctcgcggatgatcgggatgattacgactacctg
atgcagacgtccacgtactattattctgtgagaatcttccctggacaagagccggccagc
gtctgggtgggctggatcacgtccgacttccaccagtatgacacgggcttcgacttggac
agagttcgcacagtaaccgttactctgggcgacgaaaaaggaaaagtgcacgaaagcatc
aaacgcagcaactgctacatggtgtgtgcaggcgagagcatgagccctgggcaaggacgc
ggcaacaatgggctggagatcggctgcgtggtggacgcagccactgggctgctcacgttc
acggccaatggcaaggagctgagcacgtactaccaggtggagccgagtaccaaattattc
cctgcagtttttgcacaagctacaagtcccaatgtttttcagtttgagttgggaagaatt
aagaacgtgatgccgctgtctgccgggctgttcaagagtgagcacaggaaccccgtgccg
cagtgcccgccgcgcctgcacgtgcagttcctgtcgcacgtcctctggagccggatgccc
aaccagttcctgaaggtggacgtgtcgcgggtcagcgagcgccagggctggctggtgcag
tgcgcggagcccctgcagttcatgtcgctgcacatcccggaggagaacaggtccgtggac
atcctggagctgacggagcaggaggagctgctgcgcttccaccaccacacgctgcggctc
tactcggccgtgtgcgcgctgggcaaccaccgcgtagcgcacgcgctctgcagccacgtg
gacgagccgcagctgctctacgccatcgagagcaagtacatgcccggcctgctgcgcgcc
ggctactacgacctgctcatcgacatccacctgagcgcctacgccaccgcgcggctgcgg
atgaccaagagcatcacgctcttcccggatgcgcacaaggagcacgggctgccgggcatc
ggcctcagcacctcgctgcgcccgcgcatgcgcttctcctcgcccagctttgtgnncatc
aatcacgactgctaccaggacagccccgagttcccgctggacacgctcaaggccaagacc
atgcagatgctgaccgaggcggtgcgagagggcggcctgcgcgcgcgggacccggtcggg
ggcaccaccgagttcctcttcgtgccgctcatcaagctcttctacacgctgctcatcatg
ggcgtcttccacggcgaggacctgaagcacatcctgcagctgattgagccccgggtcttc
acggaggccaccccggaggcggagtgccaggcgcggtccnnggccgacgacgccaggccc
gagggcatgcgtggggacgcggcggagggtctgctgcagatgaagctgccggccgtgaga
agctgaatgtgcctgctgctccagtacctctgtgactgccaggtccggcaccggatagaa
gccatcgtggccttttcggataactttgtagctaagctccaagacaaccagcgcttccgc
tacaatgaagtcatgcaagccctgaacatgtcggctgcactcacagccaggaagacgagg
gaatttcggtcaccacctcaagaacagatcaatatgcttctcaattttaaggatgacaaa
agtgaatgtccgtgtcctgaagaaatccgggaccaactcttggattttcacgaagatcta
atggcacattgtggaattgagctgggtgaggacgggtctctggatggaagcagcgatctg
acaattaaaggccgcctgctgtccctggtagaaaaggtgacatacctgaagaagaaacaa
actgaaaagccagttgagcgtgacgccaggaagtcatccacccttcagcagctgatctcg
gacaccatggttcggtgggctcaggagtccgtcattgaagacccggagctggtgagggcc
atgttcgtgctgctgcatcgacagtacgatggcatcgggggtctgatccgggccctgcca
aaaacctacactataaacggtgtttccgtggaggacaccatcaacctgctggcctctctc
ggtcagatccgttctctgctgagtgtgaggatgggcaaagaagaagagaagcttatgatc
cgtggattaggggatatcatgaataacaaagtgttttaccagcaccctaatctcatgagg
gcactgggcatgcacgagacagtgatggaggtcatggtgaatgtcctcggaggcggggag
tccaaggagatcacttttcccaagatggtggccaactgttgccgttttctttgttatttc
tgtcggataagccggcagaatcaaaaagccatgtttgaccatctcagttatttattggaa
aacagtagtgttggtctcgcctcgccatctatgagaggttcaacaccgctggatgtggct
gcagcctcggtgatggataacaatgaactggccttagctttgcgtgagcccgacctggaa
aaggtcgttcggtatctggctggctgtggactgcagagttgccagatgctggtgtgtaag
gggtacccagacattggctggaacccagtggaaggggagcggtacctcgacttcctcaga
tttgctgtcttctgtaatggggagagtgtggaggagaacgccaacgtcgtggtgaggctg
ctcatccggcggcctgagtgcttcggcccggctctgcgaggggagggcggggccgggctt
ctcgccgccatggaggaagccatccggatagcggaggacccttctcgagacggaccctcg
ccaaccagcgaatccgcgaaaacccctgacgcggaggaggaggaggacgacactatccac
atggggaacgccatcatgaccttttacgcagctctgatcgacctgctgggacgctgcgct
cccgagatgcacttgattcatgctggtaagggagaagccatcaggatcagatctattttg
agatctctgattcccctgggagatttggtgggcgtaatcagcatcgccttccagatgcca
acagtagccaaggatgggaatgtggtggagcctgacatgtctgcggggttttgcccagat
cacaaggcagccatggttttgttccttgacagggtctatgggattgaggttcaggatttc
ctcctgcatctgctagaggttggctttctgccagatctccgagctgctgcttctttagac
acggccgcgttgagtgccacggacatggccttggccctgaatcggtacttgtgcacggcc
gtgctgcctctgctgacgagatgtgcccctctttttgccggcacagagcaccatgcgtcc
ctcatcgactcgttacttcacaccgtgtacaggctttctaagggctgctcgctgaccaaa
gcccagcgggattccatagaagtttgtctgctctctatttgtggccaactgagaccttct
atgatgcagcacttactcagaagattagtatttgatgtcccgttattaaatgaacatgca
aagatgccactgaagctgctgacaaatcattatgaaaggtgctggaaatattactgcctg
cctggagggtggggaaactttggagctgcctcagaagaagaacttcatttatcaagaaag
ttgttctggggcattttcgatgccctgtctcaaaagaaatatgaacaagaacttttcaaa
ctggcactgccgtgtctgagcgcagttgcaggagctttgcctccagactacatggagtcc
aattatgtcagcatgatggaaaaacagtcgtcaatggattctgaagggaactttaaccca
cagcctgttgatacctcaaatattacaattcctgagaagctggagtactttattaacaag
tacgcggaacactcccacgacaagtggtccatggacaagttggcaaatggatggatttat
ggagaaatatattcagactcatctaaagttcagccattaatgaagccatataagttatta
tctgaaaaggaaaaagaaatctatcgctggcccatcaaggagtccctgaagacgatgctg
gcgtggggctggagggtggcgcgcacgcgcgagggcgacagcatggcgctgtacagccgc
acgcgccgcatctcgcagaccagccaggtctctgtggatgctgcccacggttacagtccc
cgggccatcgacatgagcaacgtcacgctgtctagagatctgcatgcgatggcagaaatg
atggctgaaaactaccataacatatgggcaaagaaaaagaaagtggaactggaatccaaa
ggaggtggaaaccatcccctgctcgtgccctacgacacactgacagccaaagagaaagcc
aaggacagggaaaaagcccaagacatcctcaagttcctgcagatcagtggatacgctgtg
tccagaggattcaaggacctggaactggacacgccttccattgagaagcgatttgcctac
agcttcctgcagcagctcatccgctacgtggacggtgcccatcagtacatcctggagttc
gatgggggcagcagaggcaaaggagagcatttcccctacgagcaagaaatcaagttcttc
gccaaagtcgttcttcctttaatcgatcagtatttcaaaaaccatcgcctgtacttcctg
tctgcggccagcagacctctctgctccggaggacacgcctcgaacaaggagaaggaaatg
gtgacaagcctattctgcaaacttggagttcttgtcaggcataggatttcactgtttgga
aatgatgcgacatcgattgtcaactgtcttcatattttgggtcagactttggatgcgagg
acggtcatgaagacgggcctggagagcgtcagaagcgcgctcagagcgtttctggacagc
gccgcggaggacctggagaagaccctggagaacctccggcagggccagttcacccacacc
cggagccagcccaagggcgtcacgcagatcatcaactacaccacggtggccctgctgccc
atgctgtcgtcgctgttcgagcacatcggccagcatcagttcggagaagatttaatcctg
gaagatgtacaggtgtcatgttacagaattctgaccagcttatatgctttgggaacgagc
aagagcatttatgtggaaaggcaacgttctgcattaggagaatgtctggctgccgttgct
ggtgcctttcctgtggcgtttttggaaacgcatctcgacaaacataatatttactctgtc
tacaatactaagtcctcacgagagcgagcagctctcaacctgccggccagcgtggaagac
gtctgtccgaacatcccgtccttggagaagctcatgggcgagatcgtggaggtggccgag
tccggcgtccgctacacgcagatgccgcacgtgatggaggtcgtcctgcccctgctgtgc
agctacctgtctcgctggtgggagcacggccccgagagcaacccggcccgggccgcgacg
tgctgcacggcgctcagctccgagcacatgaacaccctgctgggcaacatcctgaagatc
atctacaacaacctgggcatcgacgagggcgcctggatgaagaggttggcagtattttcc
cagcctattataaacaaagtgaaacctcagctcttgaaaactcatttcttgccactgatg
gagaaactcaagaaaaaggccgcgatggtggtgtctgaagaagagcatctgaaagccgag
gccaggggggacatgtccgaggccgagctgctcatcctggacgagttcaccacgctggcc
cgagacctctatgccttctacccgctcttgattagattcgtggactataacagggcgaag
tggctcaaagagccaaacccagaagccgaggaccttttccgcatggtggccgaagtcttc
atctactggtcgaaatcccataatttcaaaagagaagagcagaacttcgtcgtacagaat
gaaatcaacaacatgtctttcctcattacagacaccaagtcaaagatgtcaaaggcggcg
gtgtctgaccaggagcggaagaagatgaagcgcaagggagaccgctactccatgcagaca
tccctcatcgtggcggctctgaagcggctgctgcccatcggcctcaacatctgcgctccg
ggcgaccaggagctcatcgcgctggccaagagccggctcagcatgaaagacactgaggaa
gaagtacgcgacatcatccgcagtaacattcacttacagggcaagttggaggaccctgcc
atcagatggcagatggctctttacaaagacttgccgaacaggactgaagacagttcggat
cccgagaagacagtagaaagagtgctggacatagcaaatgtgcttttccatcttgaacag
gtggagcatccgcagaggtccaaaaaggccgtctggcacaagctgctctccaagcagagg
aagagggccgtggtggcctgcttccgcatggctccgttgtataacctgccaaggcatcgg
gctgttaatctctttcttcagggatatgaaaagtcctggattgaaacagaagaacattac
tttgaagataaactgatagaagatttagcaaagcctggagcggagcccgcagaggacgag
gacggcgccaggagagtcgaccctctgcaccagctgatcctgctgtttagccggacggcc
ctgacggagaaatgcaaactggaggaagattttttatacatggcttatgcagatattatg
gcaaagagttgtcatgacgaggaagaagatgatggtgaggaagaagtgaagagttttgaa
gtcacaggatcgcagcgcagcaaggaaaaagaaatggaaaagcaaaagcttctgtaccag
caagcccggctgcacgaccgcggtgccgcggagatggtgctgcagacggtcagcgccagc
aaaggggagaccgggccgatggtcgccgccacgctgaagctcggcatcgccatcctgaac
ggcgggaacgccacggtgcagcagaaaatgctcgactacctcaaggagaagaaggacgtc
ggcttcttccagagcctggccggcctcatgcagtcctgcagtgtcctcgacctcaatgcc
tttgagcgacaaaacaaagctgaaggactcggaatggtgacagaggaaggatcaggagaa
aaggtcctgcaggatgatgagttcacctgtgacctgttccgcttcctgcagctgctttgt
gaggggcacaactcagattttcagaattacctgagaacgcagaccggcaacaacaccact
gtcaacatcatcatctccaccgtcgactacctgctgcgggtccaggagtcggtcagcgat
ttctactggttctactccgggaaagacgtcatcgacgagcaaggacagaggaatttctcc
aaagcgattcaggtcgccaagcaggtgttcaacacactcacggagtacattcagggcccg
tgcactggcaaccagcagagcctggcgcacagccggctgtgggacgcggtggtgggcttc
ctgcacgtgttcgcgcacatgcagatgaagctgtcccaggattccagtcagatcgagctg
ctgaaggagctgatggacctgcagaaggacatggtggtgatgctgctgtccatgctggaa
ggtaacgtcgtgaacgggaccatcggcaagcagatggtcgacatgctggtggagtcgtcc
aacaacgtggagatgattctgaaattcttcgacatgttcttaaaactgaaggacttgaca
tcttctgacacatttaaggaatacgaccccgatggcaagggcatcatttccaagagggag
ttccacagagtgatggagagccacaagcactacacgcagtccgagactgagttcctcctg
tcctgcgtggagacggacgagaacgagaccctcgactacgaggggttcgtcaagcgtttc
catgagcccgcgaaggacatcggcttcaacgtcgccgtgctcctgacgaacctctccgag
cacatgcccaacgacacgcggctgcagaccttcctggagctagccgagagcgtgctcaac
cacttccagcccttcctaggccgcatcgaggtcatgggcagcgccaagcgcatcgagagg
gtttacttcgaaatcagcaagtccagccggatgcagtgggagaagccgcaggtcaaggag
tccaagaggcagttcatcttcgatgtggtcaacgagggcggtgagaaggagaagatggag
ctcttcgtgaacttctgcgaggacaccatcttcgagatgcagctggcggcccagatctcg
gagtcggactcgaacgagcgctcggccagcaaggaggagagcgaggcggagaagccggag
gagcaggggccgcgcatggccttcttctccatgctgaccgtcggggccgccctgctcgcg
ctcaggcacaacgcgctgaccctcctgcggatgctcagcctgaagagcctgcggaaacag
gtgaagaaggtgaagaagatgacggtgcgagatatggccgccgccctcttctgctcctac
tggggtgtgtcgctgagcctgctgcacttcgcggccagcgtgctcagaggcttctcccgc
atcgtctgcagcctgctgctgggaggcagcctcgtggagggcgccaagaagatcagagtg
gctgagcttttggccaacatgccggaccccacgcaggatgaggtgcggggagacggcgag
gaggccgagaggaagccactggaagccgccctgccctccgaggacctcacggatctgaag
gagctgacggaggaaagtgacctcctctcggacatatttggcctggatctgaagagagaa
ggaggacagtacaagctcatccctcataacccgaacgccggcctcagcgacctcatgagc
aaccctgtccccgcccccgaggtgcaagacaagtgtcaggaacagaaggcaaaagaggaa
gaaaaggaagaaaaggaagaaaaatcggagcctgaaaaagccgggggagaaaatggggaa
aaagaagaaaaagccaaggaagagaaaggcaaacagaagctccggccgctgcacacacac
agatacggagaggccgaggcccccgagtcagcgttctggaagaaaatcatagcttatcaa
cagaagctgctaaactattttgctcgcaacttttacaacatgagaatgttagccttattt
gtcgcatttgcaatcaatttcatcttgctcttctacaaggtctccacttcttcggcggtt
gaaggaagggagctccccgcccgcagccctggggacagcgccgcggtgggcggcctgggc
ggcctgggcggcggggcgctgcgcgccacggccgtgcactacgtcctggaggagagcagc
ggctacatggagcccgccctgcgcatcctggccgtgctgcacaccgccatctccttctgc
tgcatcatcggctactactgcctgaaggttccactggttattttcaagcgagagaaggaa
gtagctcgaaaattagaatttgatggactttatattacagaacagccttcagaagatgat
attaaagggcagtgggatagacttgtgatcaacacacagtcatttcccaacaactactgg
gacaaatttgttaaaagaaaggtcatggacaagtacggggacttctacggccgggacagg
atcagcgagctgctcggcatggacaaggccgctctggacttcagcgacgcccgggagaag
aagaagcccaagaaagacagctccctgtcggctgtgctgagctctgtggacgtgaagtac
cagatgtggaagctcggggtcgtcttcaccgacaactccttcctctaccttgcctggtac
atgaccatgtctgttctcggacactttaacaactttttttttgctgctcatcttcttgac
atcgctatggggttcaagacgctgagaaccatcttgtcgtccgtaactcacaatggcaaa
cagctggtattaaccgtgggcttgttagctgtggtcgtgtacctgtatactgttgtggca
ttcaattttttccgaaaattctacaataagagtgaagatggagatacgccagacatgaaa
tgtgacgacatgctaacatgctacatgttccacatgtatgtcggggtccgtgctggcggg
ggcatcggcgatgagatcgaggaccccgcgggcgacgagtacgagatctaccgcatcatc
ttcgacatcaccttcttcttcttcgtcatcatcattctcttggccataatacaaggttta
attattgatgcttttggagaactcagagaccagcaggagcaagtcaaagaggacatggag
accaaatgcttcatctgtggcataggcaacgattacttcgacacggtgccgcacggcttc
gaaacgcacaccttgcaggagcacaacttggccaattacctgtttttcctgatgtatctc
ataaacaaggacgaaaccgagcacacagggcaggagtcttatgtctggaagatgtatcaa
gaaagatgctgggagttcttcccagcaggggactgtttccggaaacagtatgaagaccag
ctcaactaa

DBGET integrated database retrieval system