KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520081
Entry
107520081         CDS       T06036                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X1
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04064  NF-kappa B signaling pathway
ray04071  Sphingolipid signaling pathway
ray04210  Apoptosis
ray04217  Necroptosis
ray04622  RIG-I-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04668  TNF signaling pathway
ray04920  Adipocytokine signaling pathway
ray05132  Salmonella infection
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520081 (TRADD)
   04064 NF-kappa B signaling pathway
    107520081 (TRADD)
   04668 TNF signaling pathway
    107520081 (TRADD)
   04071 Sphingolipid signaling pathway
    107520081 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107520081 (TRADD)
   04217 Necroptosis
    107520081 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    107520081 (TRADD)
   04657 IL-17 signaling pathway
    107520081 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107520081 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107520081 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107520081 (TRADD)
   05152 Tuberculosis
    107520081 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107520081 (TRADD)
   05160 Hepatitis C
    107520081 (TRADD)
   05164 Influenza A
    107520081 (TRADD)
   05162 Measles
    107520081 (TRADD)
   05168 Herpes simplex virus 1 infection
    107520081 (TRADD)
   05163 Human cytomegalovirus infection
    107520081 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520081 (TRADD)
   05169 Epstein-Barr virus infection
    107520081 (TRADD)
   05165 Human papillomavirus infection
    107520081 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 107520081
NCBI-ProteinID: XP_016018941
LinkDB
Position
Unknown
AA seq 310 aa
MAAGPNGPEECVGSAYLFVEPSLDKVVLSDAYAHPQKKMAVYRALRTALAESGSPDVLQM
LKIHRSDRQLILQLRFCGRQPCSRFIHAYREGALRTALEIGLAEVLALGSVQLQLELRAG
AELLDNLLMDEERCLSCIFSHKPDRLRDEELAELEAALRNLTCGSGGQVGDVEVAPTPSN
SLAPSPSEEKPLPPPSGPTFLFQGQPVVNRPLNLQDQQTFARSVGLKWRKVGRSLQRSCR
ALRDPALESLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLL
GLANPDGGLA
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcggctgggccaaatgggcccgaagagtgtgtgggcagtgcatacctgtttgtggag
ccctccctggacaaggtggtcctgtcagatgcctacgctcacccccagaagaagatggcg
gtgtacagggctctgcggaccgcattggcagagagcgggagcccggacgtgctgcagatg
ctcaagatccaccgcagcgatcggcagctgatcctacagttgcgtttctgcgggcgccag
ccctgcagccgcttcatccacgcctaccgcgagggggcgctgcgcaccgcgctggaaatc
ggcttggcggaggtgctggctctgggctccgtgcaattgcaactggagctgcgtgccggc
gcggagctgctggacaacttgctgatggatgaggagcgctgtttgagttgtatcttctct
cataaacccgaccggctccgggacgaggaactcgctgagctggaggctgcgctccggaat
ctgacgtgcggttcggggggccaggttggagacgtggaggtcgctccaaccccttcgaac
tccctggccccctctccgtcggaagagaagccactgccgccaccatctggcccgactttt
ctattccagggtcagcccgtagtgaaccggccgctaaaccttcaggaccaacagacgttc
gcgcgctcagtgggcctcaaatggcgcaaggtggggcgctccctgcagcgtagttgtcgc
gcactgcgggacccggcgctcgaatccctggcctatgagtatgaacgcgaggggctgtat
gagcaggccttccagcttctgcggcgcttcgtgcaggccgagggccgccgtgccacgctg
cagcgcctggtggaggcactggaggaaaatgagctcaccagcctggcagaagatttgctg
ggcctagcgaatcctgatggcggcctagcctag

DBGET integrated database retrieval system