KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520293
Entry
107520293         CDS       T06036                                 

Gene name
SLC4A2
Definition
(RefSeq) LOW QUALITY PROTEIN: anion exchange protein 2
  KO
K13855  solute carrier family 4 (anion exchanger), member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107520293 (SLC4A2)
   04971 Gastric acid secretion
    107520293 (SLC4A2)
   04972 Pancreatic secretion
    107520293 (SLC4A2)
   04976 Bile secretion
    107520293 (SLC4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107520293 (SLC4A2)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   107520293 (SLC4A2)
SSDB
Motif
Pfam: Band_3_cyto HCO3_cotransp PTS_EIIA_2
Other DBs
NCBI-GeneID: 107520293
NCBI-ProteinID: XP_016019381
LinkDB
Position
Unknown
AA seq 1208 aa
MDFLLRPQPEPESSGSVAPRFPEQDEDELHRTLGVERFEEILQEAGSRGGEEPGRSYGEE
DFEYHRQSSHHIHHPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGETPTIEEGEEDED
EASEAEGPRALTQPSPASTPSSVQFFLQEDEGTDRKAERTSPSPPPPLPHQEAAPRATKG
AQTGATVEEAVAVASGTAGGDDGGASGRPLAKAQPGHRSYSLQERRRIGSMTGAEQALLP
RVPTDESEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSVQTVREGREPGPTPRAR
PRAPHKPHEVFVELNELLLDKNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSL
LELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDE
KDFSFPRNISAGSLGSLLGHHHGQGAESDPHVTEPLIGGVPETRLEVERERELPPPVPPA
GITRSKSKHELKLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPV
RFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLP
PSEVQGEELLRSVAHFQRQMLKKREEQGRLVPPGAGLEPKSAQDKALLQMVEVAGAVEDD
PLRRTGRPFGGLIRDVRRRYPHYLSDFRDALDPQCLSSSTLRRLLSPYRQLFLPPPQDLI
ARSPRRCRGPSCFPLRPSSLPCPHKGRWRKARLRVGARTSRVIYVCSGAGFLEGASLLGV
RGEDMQDPSGCRRIMSTAHPGRHFPVPRIHILAPPSSGWNHIPQLDFLQQTSCLNLNPYS
GLVFWIFQEHPLHGCSVSNSSEAMGQRREADSGDNTTWAGAGATLGPGNGSSAGPSGQGR
PRGQPTLLHFLNRLLPAPVLPWCVGLSKLSVPSGFSVTAPEKRGWVINPLGENSSFPVWM
MVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPW
LAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSMVIGDLLRQI
PLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTLRMHLFTALQLLC
LALLWAVMSTAASLAFPFILILTVPLRMVVLTRIFTEREMKCLDANEAEPVFDEREGVDE
YNEMPMPV
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggacttcctcctgcgccctcagccagagccagagagctcgggttccgtggcaccccgg
ttcccggagcaggacgaagatgaacttcaccgcaccctgggtgtggagcggttcgaggag
atcctccaggaggctgggtctcgaggaggggaggagccaggccgcagctacggggaggaa
gactttgaataccaccgccagtcctcacaccacatccatcacccgctgtccacccacctg
cctccggacgcccgccgccgcaagacaccccagggcccaggacggaagcctcgaaggcgc
cccggagcctcccccaccggggagacgcctaccattgaggagggggaggaagacgaggat
gaggccagcgaggccgagggtccccgggcactcacccagccgtcccctgcctccacaccg
tcttcagtacagttctttctccaagaagatgaaggcactgaccggaaggcagaaaggacc
agtccctctccccctccaccactgccccaccaggaggcagctccccgggccaccaaaggg
gcccagactggagccacggtggaagaggcagtggccgtggccagcggcacggcaggaggt
gatgatgggggtgcctccgggcgccccctggccaaagcgcagccggggcaccgcagctac
agcctgcaggagcggaggcgcattgggagcatgaccggcgccgagcaggcgctgctgccg
cgggtccccacggacgagagcgaggcccagacgctggccacggccgacctggacctcatg
aagagccaccggtttgaggacgtccctggggtgcggcggcacttggtgaggaagaatgcc
aaagggtccgtgcagactgtccgggaagggcgcgagcctggccccacgcctcgggcccgg
ccccgggctccccataagcctcacgaggtgtttgtggaactgaatgagttgctgctggac
aaaaaccaggagcctcagtggcgggagacggcacgctggatcaagttcgaagaggatgtg
gaggaggagacggagcgctgggggaagccccacgtggcctccctgtccttccgcagcctc
ctggagctccgccggaccctggcccacggggccgtgctcttggacctggaccagcagacc
ctgcccggagtggcccaccaggtggtggagcagatggtcatctctgaccagatcaaggcc
gaggacagagccaacgtgctgcgggccctgctgctgaaacacagccacccaagtgatgag
aaggacttctcctttccccgaaacatctctgccggctccctgggctccctgctggggcat
caccatggtcagggggccgagagcgacccccacgtcaccgagcctctcatcggaggtgtc
cctgagactcggctggaggtggagcgagagcgcgagctgccacctccagtgccaccggcc
ggcatcacgcgctccaagtccaagcacgagctgaagctgctggagaagatccccgagaac
gccgaggctacagtggtcctcgtgggctgcgtggagttcctctcccggcccaccatggcc
ttcgtgcggctgcgggaggcggtggagctggacgcggtgctggaggtgccggtgcccgtg
cgcttcctcttcctgctgctgggcccgagcagcgccaacatggactaccacgagatcggc
cgctccatctccaccctcatgtccgacaagcaattccacgaggcggcctacctggcggat
gagcgggaggacctgctgaccgccatcaacgccttcctggactgcagcgtggtgctgccg
ccctcggaagtgcagggcgaggagctgctgcggtccgtcgctcacttccagcgccagatg
ctcaagaagcgggaggagcagggccggctggtgcccccgggggccgggctggagcccaag
tcggcccaagataaggcgctcctgcagatggtagaggtggccggcgctgtggaggacgat
ccccttcggcggacaggccggcccttcggggggctgatccgggatgtgcggcgccgctat
ccccactacctgagtgacttccgggacgcgctcgacccccagtgcctgtcatcctctact
ttgcggcgccttctatccccctaccgtcagctgttcctgccacccccgcaggacctgatc
gctcgatcaccacggcgctgccgtggaccgtcatgcttccctttgaggccctcttctctc
ccctgtccccataaggggcgctggcgtaaggcgaggcttcgggtgggggcccgcacgtcc
cgggtcatctacgtctgctccggcgcggggttcctggagggagccagcctcctgggtgtg
aggggagaagacatgcaggacccttcggggtgtcggaggatcatgtccacggcgcatcca
gggcgtcatttccctgttccccgcatccacatccttgctcctccttcctccggctggaac
cacattccccagctggacttcctacagcagaccagctgtctcaatctcaacccttactca
ggcctggttttctggatcttccaggaacaccccctccacggctgttcggtgtccaacagc
tccgaggccatgggacagcggcgggaagcagacagcggcgataataccacgtgggctggg
gcaggagccacgctggggccggggaatgggagctcagcagggccgtctgggcaggggagg
ccccggggccagcccacacttttacactttcttaatcgccttcttcctgccccggttctt
ccctggtgtgtgggcctctcgaaactgagtgtgcccagtggattctcagtgacagccccc
gaaaagcggggctgggtcatcaaccccctgggcgagaacagctcctttcctgtgtggatg
atggtggcgagcctgctccccgccatcctggtcttcatcctcatcttcatggagacgcaa
atcaccacgctcatcatctcgaagaaggagcgcatgctgcagaagggctccggcttccac
ctggacctgctgctcatcgtggccatgggcggcatctgcgccctctttggcctgccctgg
ttggctgctgccaccgtccgctccgtcactcacgccaacgcgctcaccgtcatgagcaag
gctgtggcgcctggggacaagcccaagatccaggaggttaaggagcagcgggtgacgggg
ctgctggtcgcccttcttgtgggcctctccatggttatcggggacctgctccggcagata
cccctggccgtgctcttcgggattttcctgtacatgggcgttacctcccttaacgggatc
cagttctatgagcggctgcacctgctgctcatgccacccaaacaccacccagatgtcacc
tatgtcaagaaggtccggaccctccgtatgcacctgttcacagccctgcagctgctctgc
ctggccctgctctgggcggtcatgtccacagctgcctccctggccttccccttcatcctc
atcctcacagtgccgctccgcatggtggtgctcacccgcatcttcaccgagcgagagatg
aaatgcctggacgctaacgaggcagagccggtgtttgatgagcgggagggtgtggatgag
tacaacgagatgcccatgcccgtgtag

DBGET integrated database retrieval system