KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520305
Entry
107520305         CDS       T06036                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04218  Cellular senescence
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05168  Herpes simplex virus 1 infection
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107520305 (RHEB)
   04151 PI3K-Akt signaling pathway
    107520305 (RHEB)
   04152 AMPK signaling pathway
    107520305 (RHEB)
   04150 mTOR signaling pathway
    107520305 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107520305 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    107520305 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107520305 (RHEB)
   04919 Thyroid hormone signaling pathway
    107520305 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    107520305 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    107520305 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107520305 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107520305 (RHEB)
   05163 Human cytomegalovirus infection
    107520305 (RHEB)
   05165 Human papillomavirus infection
    107520305 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ray04031]
    107520305 (RHEB)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    107520305 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 107520305
NCBI-ProteinID: XP_016019430
LinkDB
Position
Unknown
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcagtttgttgaaggccaatttgtggactcctacgatccaaccatagag
aacactttcacaaaattgatcacagtaaatggacaagaataccatcttcaacttgtagac
acagctgggcaagatgaatattccatctttcctcagacatactccatagatattaatggt
tacattcttgtgtattctgttacatcaatcaaaagtttcgaagtgattaaagttatccat
ggcaaattgttggacatggtggggaaagtgcaaatacctattatgttggtcgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaggcgttagcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt
agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc
tgctcagtgatgtaa

DBGET integrated database retrieval system