KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520319
Entry
107520319         CDS       T06036                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00330  Arginine and proline metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04066  HIF-1 signaling pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04611  Platelet activation
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107520319 (NOS3)
   00330 Arginine and proline metabolism
    107520319 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107520319 (NOS3)
   04371 Apelin signaling pathway
    107520319 (NOS3)
   04066 HIF-1 signaling pathway
    107520319 (NOS3)
   04020 Calcium signaling pathway
    107520319 (NOS3)
   04071 Sphingolipid signaling pathway
    107520319 (NOS3)
   04022 cGMP-PKG signaling pathway
    107520319 (NOS3)
   04151 PI3K-Akt signaling pathway
    107520319 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107520319 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107520319 (NOS3)
   04921 Oxytocin signaling pathway
    107520319 (NOS3)
   04926 Relaxin signaling pathway
    107520319 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107520319 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107520319 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107520319 (NOS3)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107520319 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 107520319
NCBI-ProteinID: XP_016019454
LinkDB
Position
Unknown
AA seq 1200 aa
MGNMKSVGQDPGPPCGLGLGLGLGLCSKQGPASPVSEPSWTPAPAPLPEPGHSPPPTRSP
EGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSQGPPPPEQL
LSQARDFINQYYSAIKRSGSQAHEQRLEEVEAQVAATGTYQLQESELVFGAKQAWRNAPR
CVGRIQWGKLQVFDARDCSSAQEMFTYICSHIKYSTNKGNIRSAITVFPQRAPGRGDFRI
WNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELF
TLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYTSTEIG
SRNLCDPHRYNILEDVAVCMDLDTRTSSSLWKDKAAVEINLAVLHSYQLAKVTIVDHHAA
TSSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGS
TARGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFR
KAFDPRVLCMDEYDVVFLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRP
EQHRSYKIRFNSVSCSDPLVSSWRRKRKASSNTDSAGALGTLRFCVFGLGSRAYPHFCAF
ARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAAQDI
FSPKRSWKRQRYRLTAQDECLQLLPGLMYVHRRKIFQATVLSVENLQSSKSTRATILVRL
DTGGKEGLQYQPGDHIGICPPNRPGLVEALLSRVEDLPPPGDTLAVEQLEKGSPGGPPPG
WVRDPRLPPCTLRQALTFFLDITSPPSPRLLQLLSTLAEEPGEQQELETLSQDPRRYEEW
KWFRCPTLLEVLEQFPSVALPAALLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLAYR
TQDGLGPLHYGVCSTWLSQLKAGNPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRG
FWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSREPGS
RKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDEAG
DVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWSFDPPGSDTPGS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgggcaacatgaagagcgtgggccaggaccctgggccgccctgcggcctggggctgggg
ctgggcctcgggctgtgcagcaagcagggcccagcctccccggtgtctgagcccagctgg
acgccagcacctgcacccctgcctgagccaggccacagccccccgcccacccggtcccca
gaggggcccaagttcccgcgcgtgaagaactgggaggtggggagcatcacctacgacacc
ctgagtgcccaggcacagcaggacggaccctgcaccccaagacgctgcctgggctccctg
gtatttccacggaaactgcagggccggccgtcccagggccccccaccccccgagcagctg
ctgagccaggccagggacttcatcaaccagtactacagcgccatcaagcggagcggctcc
caggcccacgagcagcggcttgaggaggtggaagcccaggtggcggccacaggcacctac
cagcttcaggagagcgagctagtgttcggggccaagcaggcctggcgcaacgctccccgc
tgcgtgggccggatccagtgggggaagctgcaggtgtttgacgcccgtgattgcagctct
gcgcaggagatgttcacctacatctgcagccacatcaagtactccaccaacaagggcaac
atccgctcggcaatcacagtgttcccccaacgcgccccgggccgcggggacttccgcatc
tggaacagccagctggtgcgctacgcgggctaccggcagcaggacggctccgtgcgcggg
gacccggccaacgtggaaatcaccgagctctgcatccagcacggctggaccccgggaaac
ggccgcttcgacgtgctgcccctgctgctccaggccccggacgagcccccagaactcttc
actctgccccccgagctggtcctcgaggtgcccctggagcaccccacgctggagtggttc
gcggccctgggcctgcgctggtatgccctcccggccgtgtccaacatgctgctggagatc
gggggcctggagttccccgcggcgcccttcagcggctggtacacgagcaccgagatcggc
tcgcggaacctgtgcgacccgcaccgctacaacatcctggaggatgtggccgtctgcatg
gacctggacacccggacgtcctcgtccctgtggaaagacaaagcagctgtggaaatcaac
ttggccgtgctgcacagttaccagctggccaaagtgaccattgtggaccaccatgcggcc
acctcctccttcatgaagcacctggagaacgagcagaaggcgagggggggctgccctgcc
gactgggcctggatcgtgccccccatctcgggcagcctcacccctgtcttccatcaggag
atggtcaactatttcctgtcccctgcctttcgctaccagccggatccttggaaggggagc
acagccaggggtgccggcatcaccaggaaaaagacctttaaggaagtggccaatgcggtg
aagatctccgcctcactcatgggcaccgtgatggccaagcgtgtgaaggccacgatcctg
tatggctctgagaccggccgggcgcagagctacgcacagcagctggggaggctcttccgg
aaggctttcgacccccgggtcctgtgcatggatgagtatgacgtggtgttcctcgagcac
gagacgctggtgttggtagtgaccagcacatttgggaatggggatcccccagaaaacgga
gagagtttcgcagcggccctgatggagatgtccggcccctacaacagctcccctcggccc
gagcagcacaggagttacaaaatccgcttcaacagcgtctcctgctcagaccccctcgtg
tcctcctggcggcggaagagaaaggcgtccagtaacacggacagcgccggggccctgggg
accctcaggttctgcgtgttcgggctgggctcccgggcgtacccccacttctgcgccttt
gctcgtgcggtggacacgcggctggaagagctgggtggggagcggctcctgcagctgggc
cagggcgacgagctgtgcggccaggaggaggccttccgcggctgggcccaggctgccttc
caggcctcctgtgagaccttctgcgtgggcgaggacgccaaggccgccgcccaggacata
ttcagccccaaacggagctggaagcgccagaggtaccggctgacggcccaggatgagtgc
ctgcagctgctgccaggcctgatgtatgtgcacagacgaaagattttccaggccacggtc
ctctcagtggaaaacctgcagagcagcaagtccacccgggctaccatcctcgtgcgcctg
gacaccggaggcaaggaggggctccagtaccagccaggcgaccacataggcatctgcccg
cccaaccggcccggcctcgtggaggcgctgctgagccgcgtggaggacctgccgccacca
ggggacaccttggcagtggagcagctggagaagggcagccctggtggccctcccccgggc
tgggtgcgggacccccggctgcccccatgcaccctgcgccaggctctcaccttcttcctg
gacatcacttccccgcccagcccccgactccttcaactgctcagcaccctggctgaagag
cccggggaacagcaggagctggagaccctcagccaggacccccggcgctacgaggagtgg
aagtggttccgctgccccacgctgctggaggtgctggagcagtttccgtcagtggctctg
cccgccgcgttgctcctcacccagctgcccctgctccagccccggtactactcggtcagc
tcggcgcccagcgcccaccccggagagatccacctcacagtggccgtgctggcctacagg
acccaggatgggctgggccccctgcactacggcgtctgctccacgtggctgagccagctc
aaggccggaaacccggtaccctgcttcatcaggggggctccctccttccggctgccacca
gaccccagcttgccctgcatcctggtgggcccaggcactggcatcgcccccttccggggc
ttctggcaggagcggctacatgacattgagagcaaagggctgcagcccgcccctatgacc
ttggtgttcggctgccgatgctcccagctggaccacctctaccgcgacgaggtgcaggac
gcgcagcagcgcggagtgtttggccgcgtcctcaccgccttctcccgggaacccggcagc
cgtaagacctacgtacaggacatcttgcggacagagctggccgccgaggtgcaccgcgtg
ctgtgcctcgaacgaggccacatgtttgtctgcggcgatgtcaccatggcaaccagcgtc
ctgcagacagtgcagcgcatactggcgacagagggcgacatggagctggatgaggccgga
gacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacattttcgggctcacg
ctacgcacccaggaggtgacaagccgcattcgcacccagagcttttccttgcaggagcgg
catctgcggggcgcagtgccctggtcgttcgacccgcccggctcagacacccccggctcc
tga

DBGET integrated database retrieval system