KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520348
Entry
107520348         CDS       T06036                                 

Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04340  Hedgehog signaling pathway
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107520348
   04024 cAMP signaling pathway
    107520348
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520348
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107520348
SSDB
Motif
Pfam: EGF_2
Other DBs
NCBI-GeneID: 107520348
NCBI-ProteinID: XP_016019529
LinkDB
Position
Unknown
AA seq 328 aa
MITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDP
GRCAVDRHPTDVNINLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPVV
GGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLASSGSCRGYFSGHIL
GFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLVPEECRAAVQPAQTLASECSRLC
RNGYCTPTGTCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRN
IRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 987 nt   +upstreamnt  +downstreamnt
atgatcacactggatgacatggaagaaatggatgggttaagtgacttcacaggctcggtg
ctccggctggacgtggacacagacatgtgcaacgtgccttattccatcccaaggagcaac
ccgcacttcaacagcaccaaccagccccccgaagtgtttgcgcacggcctccacgatcca
ggcaggtgtgctgtggatcgacatcccacggatgtaaacatcaatttaacaatactttgt
tcagactccaatggaaagaacagatcatcagccagaatcctacagataataaaggggaaa
gattatgaaagtgagccatcacttttagaattcaaaccattcagtaatggtccagtggtt
ggcggatttgtttaccgaggctgccagtccgaaagactgtatggaagctacgtgttcggg
gaccgtaatgggaatttcttaactctccagcaaagtcccgtgaccaagcagtggcaggaa
aaaccactctgcctcgccagcagcgggtcctgtagaggttacttttcgggtcacatattg
ggattcggagaagacgaattaggtgaagtttacattctttcgagtagtaaaagtatgact
cagactcacaatggaaaactctacaaaattgtagatcccaaaagacccctcgtgcctgag
gaatgcagagcagccgtgcagcctgcccagacactggcttcggagtgctcccggctctgt
cggaacggctactgtacccccacaggaacatgctgctgcagcccgggatgggaaggagac
ttctgcagaatcgcaaaatgtgagccggcatgtcgtcatggaggcgtctgtgttagaccc
aacaaatgcctctgcaaaaaaggctatcttggtcctcagtgtgaacaagtggacagaaac
atccgcagagtgaccagggcaggtattcttgatcagatcattgacatgacatcttatttg
ctggatctaacaagttacattgtatag

DBGET integrated database retrieval system