KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520360
Entry
107520360         CDS       T06036                                 

Definition
(RefSeq) uncharacterized protein LOC107520360
  KO
K17901  calcipressin-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107520360
   04919 Thyroid hormone signaling pathway
    107520360
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107520360
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107520360
SSDB
Other DBs
NCBI-GeneID: 107520360
NCBI-ProteinID: XP_016019560
LinkDB
Position
Unknown
AA seq 237 aa
MALPLTSKAALRLQAEGRALRPWDPAGGAARRGCVCPSRADCHGLRRDRERVNRGGRGPE
TARARRASPAPPTGARGRGDGDDGVAGPQLGEAAQAAEAAGARPALTLRPFAPFPGVAEA
DESGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRNPILGPASEGSRQAMSPS
FLTYKRRNSAFLRQQAEDEERECAQGAGLGSWEIASRDSRELLSPVISIVGIVALCC
NT seq 714 nt   +upstreamnt  +downstreamnt
atggctttgcccctaaccagcaaggccgctctgaggcttcaggctgagggcagggcactc
cgcccctgggacccggcgggcggggcggcgcgcaggggctgcgtctgcccgagccgcgcg
gactgtcacggcctgcgacgcgaccgcgagagggttaaccgcggcggccgcggaccggag
acagcgagggcccggcgcgcgagcccggcgccgccgacgggggcgcgcgggcgcggggat
ggagacgacggcgtggccgggccgcagctcggggaggcggcccaggcggccgaggcggcc
ggagcgcgacccgcgttgacgctgcggcccttcgcgccgttcccgggggtggccgaggcc
gacgagagcggcggcgactggagcttcatcgactgcgagatggaggaggtggacctgcag
gacctgcccagcgccaccatcgcctgccacctggacccgcgcgtgttcgtggacggcctg
tgccggaatccgattctgggtccagcgtccgagggaagtaggcaggccatgtcgccttcg
tttctcacctacaaaagaagaaacagtgccttcctcaggcagcaggctgaggacgaagaa
agagaatgtgcacagggcgccggcctcggttcctgggagatagcaagtcgggattcacgg
gagctgctgtctcccgtcatctccatcgtcggcatcgtcgctctctgctgctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520373
Entry
107520373         CDS       T06036                                 

Gene name
RCAN1
Definition
(RefSeq) calcipressin-1
  KO
K17901  calcipressin-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107520373 (RCAN1)
   04919 Thyroid hormone signaling pathway
    107520373 (RCAN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520373 (RCAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107520373 (RCAN1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107520373 (RCAN1)
SSDB
Motif
Pfam: Calcipressin GOLD_2
Other DBs
NCBI-GeneID: 107520373
NCBI-ProteinID: XP_016019584
LinkDB
Position
Unknown
AA seq 197 aa
MHFRNFNCSFSSLIACVANSDIFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSN
PLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV
EDATPVINYDLLYAISKLGPGQKYELHAATDTTPSVVVHVCESDQEDEEEDEPERAKRPK
PKIIQTRRPEYTPLHLS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgcattttagaaattttaactgcagttttagctccttgattgcctgtgtggcaaacagt
gatatcttcagcgaaagtgaaaccagggccaaatttgaatccctctttaggacatatgac
aaggacatcacctttcagtattttaagagcttcaaacgtgtcagaataaacttcagcaac
cccttgtctgcagcagacgccaggctccagctacataagactgaatttctcggaaaggag
atgaaattgtattttgctcagactttgcacatagggagctcgcacctggctccccccaat
cccgacaagcagtttctgatctctcctcctgcctctccgcccgtcggctggaagcaagtg
gaagacgccacccccgtcataaactatgatcttttatacgccatctccaagctggggcca
gggcagaagtacgaactgcacgcagcgaccgacaccacgcccagcgtggtggtccacgtg
tgtgagagcgaccaggaggacgaggaggaggacgagccggagagggcgaagaggcccaag
cccaaaattatccagaccagaaggccggagtacacgcccctccacctaagctga

DBGET integrated database retrieval system