KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520393
Entry
107520393         CDS       T06036                                 

Gene name
PLCE1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 isoform X1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04919  Thyroid hormone signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05205  Proteoglycans in cancer
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107520393 (PLCE1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107520393 (PLCE1)
   04015 Rap1 signaling pathway
    107520393 (PLCE1)
   04020 Calcium signaling pathway
    107520393 (PLCE1)
   04070 Phosphatidylinositol signaling system
    107520393 (PLCE1)
   04024 cAMP signaling pathway
    107520393 (PLCE1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107520393 (PLCE1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107520393 (PLCE1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107520393 (PLCE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107520393 (PLCE1)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107520393 (PLCE1)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107520393 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107520393 (PLCE1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Other DBs
NCBI-GeneID: 107520393
NCBI-ProteinID: XP_016019634
LinkDB
Position
Unknown
AA seq 2302 aa
MTSEEMAASVLIPVTQKKVVSSQSAVDESSDKVLDVSVSKAHTVRQSGSIPSYTISKPNK
LKEESSGSNLPKILSIAREKIMSDENSNEKCWEKNTPDSVEDPNINCNNISENHQHGLPQ
SQFYETCDSLTEEGLCLETGIPSSLERKVFPGIQLEMNRPPMGIRALGNQSATIEPGKAQ
PDGNMAVFHFHYELDRRMSDTFCTLSDNLILGDCGNCVSLPGVGEEQKKNYNAYTCKLME
LAENCDNENGQLQCDHCDTLNDKYLCCEGSCQKASVVCSSDSFCRKDFTDSPSAKDFLSH
FEDFPDNCEDVEDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLPSGHIGLAA
WSYIDQKRSGLSLPCGAATGWQSTVVTRQDGSQCLSEAQWYPIYNAVRRGEETEDTIGSL
LHFFTKLPDSETAHERINVGPCLKQCVLNNVCEFRATLQRTSVSQYITGSLLEATTSLGA
RSGLLNTFGGSTGRMMLKERQPATSVANSNALPSSSAGISKELIDLQPLIQFPEEVASIL
MEQEQNIYRRVLPVDYLCFLTRNLGTPECQASLPGLKASISASVLTSQNGEHNALEDLVM
RFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNTVMEFLAGLRSRKVLKM
WQFMDQCDLETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDG
TSGLLKLCPRYNSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQIIRSCSR
SLETEEEDSPNEGNSSRKNSLKDKARWQFIIGDLLDSENDIFEQPKEWDPHGLEEPQKAF
DHGTELIPWYVLSIRADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWIKPTTA
SPASAKAKLGMLSNTSEPGKFPLLGNAGLSGLVEGVLDLFSAKAVYMGHPSIDIHTVCVQ
NKLSSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQR
QQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGISAKSTEKPSMQRNNTL
GISTTKKKKKILMRGESGEATDDEMATRKAKMHRECRSRSGSDPQDANEQEESEANAIPS
PPNPLPSRRAHSLTTAVSPNLASGTSSPIRPVSSPALSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSSMSFVEFVELFKSFSVRSRKDLKDLFDLYAVPCNRAGSESAPLYTNLTI
DENTSGLQPDLDLLTRNVSNLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGVESTSLG
IFGVGILQLNDFLVNCQGEHCTYDETLSIIQKFEPSISMCHQGLMSFEGFARFLMDKDNF
ASKNDESQENVRELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDC
WDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEI
FKTVFGEKLVTKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLA
SMQAQAYNGGNANLPPATNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYN
EEIPKRIKKADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGL
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKASGKSACEGMRQAWEESSSPLS
PTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPN
PLMFWLHGIQLVALNYQTEDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLE
RDLDDMEPAIYSLTIVSGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMW
NEQFLFRVHFEDLIFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISS
LFINSRRMEENSSSSTMPASLMFNTEERKCLQTHRVTVHGVPGPEPFTVFSISGGTKAKQ
LLQQILTTEQDIKLIATDYFLMEEKYFISKEKNECRKQPFQRVIGPEEEILQILSSWFPE
EGYVGRIVLRPQQENLEEKSIVQDDKEVILSTEEESFFVQVHDVSPEQPRTVIKAPRIST
AQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTSNKRSSTPKSSQRVLLDQECVFQ
AQSKWKGAGKFILKLKEQVQASREDKRKGISFASELKKLTKSTKQPRGLTSPSQVLASES
VQNKEEKPVGGLFSSDTLDYRQ
NT seq 6909 nt   +upstreamnt  +downstreamnt
atgacatctgaagaaatggcagcttctgttctcatacctgtgactcagaaaaaagtggtg
tcttctcagtcggctgtagatgaaagtagtgacaaggtcctggatgtcagtgtttcaaag
gcacatactgttaggcagagtgggtctataccatcttataccatctcaaaaccaaacaaa
cttaaagaagaatcttctggaagcaacttgcccaagattctctcaattgcaagggagaaa
ataatgagtgatgaaaacagtaatgaaaagtgctgggagaaaaacacaccagattctgtg
gaagaccctaacattaactgcaataacatatcggaaaaccatcagcatggccttcctcag
agccagttttatgaaacgtgtgattctctcacagaggaaggcctctgtttggaaactgga
atcccttcttcactggaaagaaaggtgttccctggaattcagctggaaatgaatagacct
cccatgggcattagagccttaggcaatcagtcagcaaccatagagcctggcaaggcacaa
cctgatggcaacatggcggtatttcattttcattatgaacttgacagaagaatgtcagac
actttctgtaccctatcggataacttgattttgggtgattgtggaaactgtgtatcactg
cctggtgttggtgaggagcaaaagaaaaattataatgcatatacttgtaagctgatggaa
ttggcagaaaactgtgataatgagaatggccagctgcaatgtgatcattgtgacaccttg
aatgacaaatacttgtgctgcgaaggttcctgccaaaaggccagtgtggtatgttcaagt
gacagcttttgcagaaaggattttactgatagtccatctgctaaggactttctgagccat
tttgaagacttccctgataactgtgaagatgtagaggacttttttaaaagtaaaaaggag
cggtccactttgttagtgaggagattttgtaaaaatgacagggaagttaagaaatctgtg
tatacagggacaagggcaattatgaggactctgccttctggtcacattgggctggcagct
tggagttacattgatcagaaaagaagtggtctctcattgccttgtggggcagcaacggga
tggcagtcaacagtggtgactaggcaagatgggagccaatgtctgtcagaagcccagtgg
tatccgatctacaatgcagtgagaagaggagaagaaacagaagatacaattggatctctt
ctccatttcttcacaaagctcccagactccgagacagcccatgaaaggattaacgttggt
ccctgcttaaagcaatgtgtcctaaacaacgtttgtgaatttcgtgccaccctccaaagg
acttctgtatctcagtacatcaccggttctctcctagaggcaaccacatctttaggagca
aggagtggccttctcaatacttttggaggatctaccggacgaatgatgctgaaagaacgc
caaccagccacctccgtggccaattccaatgccctcccttcaagttcagctgggatcagc
aaggaactgattgatctgcagcccctcatccagttcccagaggaagtcgctagcatcctg
atggagcaggaacagaatatttaccgaagggtcttgccagttgactacctttgcttcctg
actcggaacttgggcactccagaatgccaggcttcactgcccggcctcaaagcgtccatc
tcagcatcagttctcacctcccagaatggagagcacaacgccctcgaagatcttgtgatg
agatttaatgaggtgagctcctgggtaacgtggctgatcctcacggcgggttccatggag
gagaagcgggaagtcttctcgtatttggtgcatgtggccaaatgctgctggaacatggga
aactacaacaccgtcatggagttcttggccggcctcaggtcaagaaaagttttgaagatg
tggcagtttatggaccagtgcgacctggagaccatgcggagcctgaaggatgccatggct
cagcacgagtcatcctgtgagtacaggaaggtggtgacgcgggctctgcacatccccggc
tgcaaggtggttccattctgcggagtgttcctgaaggagctctgtgaagttcttgacgga
acctctggccttctgaagctttgcccgaggtacaattcccaagaagaagctctagagttc
gtagccgactacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaag
aattcagaaaaggagtccacagtcaacagcatctttcagatcatcaggagctgcagtcga
agtctggagacggaggaggaggacagccccaatgaagggaacagctctaggaaaaactcc
ttgaaggataaagctcgatggcaatttataattggagatttgttggattctgaaaatgac
atttttgagcagccgaaagaatgggatcctcacggattagaagaaccgcagaaggccttt
gaccatgggacagagctcatcccgtggtacgtcctatccatccgagctgatgtgcaccag
ttcctactgcagggagccacggttatccactatgaccaggacacacacctctctgcccgc
tgcttcctccagcttcagcctgacaatagcaccttgacctggataaagcccaccactgcc
tccccagccagtgctaaagcaaaacttggtatgcttagtaacacatctgagcctggcaaa
ttcccattactgggcaatgctggattaagtggcctggtagagggggtcttggatctgttt
tcagcaaaggctgtgtacatgggacaccctagcattgatatacacactgtgtgtgttcag
aacaaactgagtagcatgtttctctcagagactggtgtgacattgctctatgggcttcag
accacggacaatagattattgcattttgtggcaccaaagcacacagctaaaatgctcttc
agcggattattggaactcactagggctgtgagaaagatgaggaagttccctgaccaaagg
cagcagtggctacggaaacaatacgtcagcctctatcaggaggatggacggtacgaaggc
ccgactttggctcatgctgtggagttgtttggtggcagacgatggagtactcgaaacccc
agccctgggatatcagcaaagagtactgagaagcccagcatgcagaggaacaacaccttg
ggcataagcaccaccaagaaaaagaagaaaatccttatgaggggtgagagtggagaggca
accgacgacgagatggccacccgaaaggccaaaatgcacagagagtgtcggagccggagt
ggctctgatcctcaagacgctaacgaacaagaagaatcagaggcaaatgccatcccaagc
ccgcctaaccctctcccttccagaagagcccactccctgaccacggctgtgtcacctaac
ttggcttccgggacatcatctcccatcaggccagtgtcctcccccgcgctgtcttcaaac
aagagcccatccagtgcttggagcagcagcagctggcatgggcggatcaaaggaggaatg
aaaggctttcagagtttcatggtttcagacagtagcatgagttttgttgaatttgttgag
ctgttcaaatcattcagtgtaaggagcagaaaggacctgaaggatctctttgacctctat
gccgtgccctgcaaccgagcaggctctgagtcagccccactctacaccaacctaaccatt
gatgaaaacaccagcggtcttcagcctgacctagatttgttgaccagaaatgtctcgaat
ttggggttgttcattaaaagtaaacagcaactgtcagacaaccagaggcagatctctgat
gccattgctgctgcaagtatcgtgacaaatggtactggggtcgagagcacatccctgggc
atatttggggttggaatactccagctcaatgactttctagtgaattgccaaggagaacac
tgcacttacgatgaaaccctcagcatcatccagaagtttgagcctagcattagtatgtgt
catcaaggcctaatgtcatttgaaggatttgcaaggtttctgatggataaagataatttt
gcctcaaaaaatgatgaatcgcaggagaacgttagagaattgcagctgcccctctcctac
tattacatcgaatcttcacacaatacctacctcacaggccatcagctcaaaggagaatcc
tcagtagagctctacagccaggttctcttgcaaggctgcaggagcgtagagttggactgc
tgggatggagatgatgggatgcccatcatttaccatggacacacactgacaaccaagatc
cccttcaaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctgcca
atcatcatatcgattgagaaccactgttcattgcctcagcaacgaaaaatggccgaaatt
tttaagactgtgtttggagaaaaactggtgactaaattcttatttgagagtgacttctca
gatgatccaatgcttccctcgcctgaccaacttagaaggaaagtgcttcttaaaaataag
aagctaaaggcccatcagacaccagtggatatcttaaagcaaaaggctcatcagttagca
tccatgcaagctcaggcttataatggtgggaatgccaacctcccacctgctactaacgag
gaggaggaagatgaagaagacgaatatgattatgactacgaatccctctctgacgacaac
attctagaagacagacctgaaaataaatcatgtaatgacaagcttcaatttgagtataat
gaagaaatccccaagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtt
tatgacatggaactgggagaagaattttatcttcctcagaataaaaaggaaagcagacag
attgcaccagagctttctgaccttgtcatctattgccaagcagtaaaatttccaggcctg
tcaactctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatt
tttggcaacaatccgggcagaatgagccctggggagacagcatcattcaacaaagcatct
ggaaaaagtgcctgcgaaggaatgcgacaggcctgggaggaatcttcttccccactcagc
ccaaccacatccctcagcgctatcattagaactcccaaatgctatcatatctcatcgctg
aatgaaaatgccgccaaacgtctgtgtcgcaggtattctcagaaactgatccagcacacc
gcctgtcagctgctgagaacctacccagctgccacccgtatcgactcgtccaaccctaac
cccctcatgttctggctgcatgggatacagctcgtggcactcaactaccaaacagaggat
ctccctttacatttaaatgctgccatgttcgaggccaatggtggctgtggttatgtttta
aaacctccagtcctgtgggacaagaactgtcctatgtatcagaagttttctcccttggaa
agagacctggacgacatggagcctgccatctattctttaactattgtctctggacaaaac
gtgtgcccgagtaacagcacaggaagcccgtgtattgaagtcgatgtcctgggaatgccc
ctggacagttgccattttcgcacgaagcccatccatcgcaataccctgaaccccatgtgg
aatgaacagtttctcttccgagttcattttgaagatctcatatttcttcgttttgccgtt
gtggaaaacaacagctcagcagtaactgctcagagaatcattccactcaaggctttaaag
cgaggatatcgacatcttcagctgcgaaacctgcacaatgaagtcttggaaatctccagt
ttattcataaacagcagaaggatggaagaaaattcctctagcagtactatgccagcctct
ttgatgtttaatacagaagaaagaaaatgtttgcagactcacagagtcacggttcatggg
gtcccaggtccagagccctttactgttttctctataagtggaggcaccaaggcaaagcag
cttctccaacaaattctgaccaccgaacaagacatcaaacttattgccacagattatttt
ttgatggaagaaaaatattttatatctaaagaaaagaatgaatgcagaaaacaaccattc
cagagagtcattggtccagaagaagagatcttacagattttaagcagctggtttccagaa
gagggatacgttggcagaattgtcttaagaccccagcaggaaaacctagaagagaaaagc
atcgtgcaagatgacaaggaggtgatcttgagcacggaggaggagagtttctttgtccaa
gtgcatgatgtttctcccgagcaaccgcggacagtcatcaaagcaccccgcatcagcacc
gcacaggatgtcattcagcagaccttatgcaaagccaaatactcctatagcatcctgagc
aaccccaacccaagtgactatgtgcttttggaagaggtggtgaaagacacctccaacaag
aggtcttctaccccaaagtcctcccagcgggtcctcttggatcaggagtgtgtgtttcaa
gcacaaagcaagtggaaaggtgcaggaaaattcatcctgaagctaaaggagcaggtgcag
gcatcccgagaagacaaaagaaaaggcatttcttttgcaagtgaactcaagaagctcacc
aagtcaactaaacagccccgaggactcacatcaccttctcaggtcttggcctcagaaagt
gtccaaaacaaggaggaaaaacctgtgggaggcttgttctccagcgacacgctagactac
cgacagtga

DBGET integrated database retrieval system