KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520585
Entry
107520585         CDS       T06036                                 

Gene name
ADCYAP1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide isoform X1
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04911  Insulin secretion
ray04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107520585 (ADCYAP1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107520585 (ADCYAP1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107520585 (ADCYAP1)
   04924 Renin secretion
    107520585 (ADCYAP1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107520585 (ADCYAP1)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 107520585
NCBI-ProteinID: XP_016020047
LinkDB
Position
Unknown
AA seq 212 aa
MPKNTPSGPLSIDLAQEMRSGFSIRTPAIGYRAGVEEARQTHGLQEAGTGQRRVAWERLC
AGPEDEAYDEDGNPLQDFYDSDPPRVGSPASALRDAYALYYPVETRDVAHGILNKAYHKL
LDQLSARKYLQTLVAKGMGGNLGDGAEDDSEPLSKRHSDGIFTDSYSRYRKQMAVKKYLA
AVLGKSYKPLHGLGLALGQERNIIGRTPGWFS
NT seq 639 nt   +upstreamnt  +downstreamnt
atgcccaagaacacgccttcggggccgctcagcattgatttggcccaagagatgcgttct
ggcttcagtattaggacgccagcaattgggtacagggcaggggtggaagaagccagacag
acccacggactccaggaagccgggacagggcagaggcgcgtcgcctgggaaaggctgtgt
gcggggccggaggacgaagcctacgacgaagacggaaacccgctgcaggacttctatgac
tctgatccgcctcgcgtagggagccccgcctccgcgctgcgcgacgcctatgcgctctac
tacccggtggagacgagagatgtcgcccacgggatccttaacaaggcctaccacaaattg
ctggaccagctgtccgccaggaaatacctgcagacgctcgtagccaagggcatgggtggg
aacctaggcgacggcgcggaggacgactcggagccgctctccaagcgccattcagacgga
atcttcacggacagctacagccgctaccggaaacaaatggctgtcaagaaatacttggcg
gcggtcctagggaaaagttacaaacctcttcatggactgggtctggccttggggcaggag
cggaacatcatcggacgtacacctgggtggttctcgtag

DBGET integrated database retrieval system