KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520648
Entry
107520648         CDS       T06036                                 

Gene name
CDH1
Definition
(RefSeq) LOW QUALITY PROTEIN: cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04371  Apelin signaling pathway
ray04390  Hippo signaling pathway
ray04514  Cell adhesion molecules
ray04520  Adherens junction
ray05100  Bacterial invasion of epithelial cells
ray05200  Pathways in cancer
ray05213  Endometrial cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107520648 (CDH1)
   04390 Hippo signaling pathway
    107520648 (CDH1)
   04371 Apelin signaling pathway
    107520648 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107520648 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107520648 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520648 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    107520648 (CDH1)
   05216 Thyroid cancer
    107520648 (CDH1)
   05218 Melanoma
    107520648 (CDH1)
   05219 Bladder cancer
    107520648 (CDH1)
   05213 Endometrial cancer
    107520648 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107520648 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107520648 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ray04515]
    107520648 (CDH1)
   04090 CD molecules [BR:ray04090]
    107520648 (CDH1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107520648 (CDH1)
Cell adhesion molecules [BR:ray04515]
 Cadherins
  Major cadherins
   107520648 (CDH1)
CD molecules [BR:ray04090]
 Proteins
  107520648 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 RET_CLD1 BACON_2
Other DBs
NCBI-GeneID: 107520648
NCBI-ProteinID: XP_016020138
LinkDB
Position
Unknown
AA seq 889 aa
MGPRCRCLNALLLLLLLQVSSWLCQEPEPCRPGFGAESYTFIVPRRHLERGRVLGRVSFD
GCAGRPGSVFISDDTRFKVGTDGVLTVKRPLQLRNPEMSFLVHAWDSSRRKLSTKVTLKA
AEHHHHHHHRRRRHHDSLSGTQTEVLTFPHSHRGLRRQKRDWVIPPITCPENQKGPFPKN
LVQIKSNREKETQVFYSITGQGADAPPVGVFIIERESGWLKVTEPLDREAIAQYILFSHA
VSSNGIPVEDPMEIVVTVTDQNDNKPEFTQEVFEGSVMEGAVPGTSVMQVTATDADDEVN
TYNAAIAYSIASQEPMLPHDKMFTINRDTGVISVLTTGLDRESFPTYTLVVVAADLQGEG
LSTSAKAVITVTDTNDNPPIFNPTTYRGEVPENEANVVITTLKVTDADVPNTPAWEAVYT
ILNDNEEQFVVTTDPVTNDGILKTAKGLDFEAKQQYILYVAVKNVAPFEVTLSTSTATIT
VDVLDVNEAPIFMPPQKRVEVSEDFPVGLEITSYTAQEPDTFMEQKITYRIWRDTANWLE
VNPDTGAISTRAKMDREDDNHVKNSTYTALIIATDNGSPVATGTGTLLLILTDVNDNAPI
PDPRNVNFCQHNPQPHIINIIDPDLPPNTSPFTAELTHGASVNWTIEYNDPEHESIILKP
KKTLELGSYKINLKLADNQNKDQVTTLDVYVCDCEGAVNGCKKDAAYVEAGLQVPAILGI
LGGILALLILILLLLLFVRRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLH
RGLDARPEVTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVF
DYEGSGSEAATLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgggccctcggtgccgctgcctcaacgcgctcctgctcctgctgctgctgcaggtctca
tcatggctctgccaggagccggagccctgccgtcctggctttggcgccgagagctacacg
ttcatcgtgccgcggcggcacttggagagaggcagagtcctgggcagagtgagttttgat
ggatgcgctggtcgaccagggtcagtctttatatctgatgacaccagattcaaagtgggc
acagatggtgtgcttacggtcaaacggcctctacagcttcgtaatcctgaaatgagtttt
cttgtccatgcctgggactccagccgcaggaagctctccaccaaagtgacgctgaaggca
gcagaacaccaccaccaccaccaccaccgccgccgccgtcatcatgactccctctctgga
acccagacagaagtgctcacgtttcctcactcccaccgtggtctcagaagacagaagaga
gactgggttattcctcctatcacctgcccagaaaatcagaaaggcccatttcctaagaac
ctggttcagatcaaatctaacagggagaaagaaacacaggttttctacagtatcaccggc
caaggagctgacgcaccccctgttggtgtgtttattatcgaaagagaatcaggatggcta
aaggtgacggaacctctggatagagaagcaattgcccagtacatcctcttctcccatgct
gtgtcttcaaacgggatcccagtcgaagacccgatggagatagtggtcacggtgacagat
cagaatgacaataagccggagttcacccaggaggtctttgaggggtctgtcatggaaggt
gctgtcccaggaacctccgtgatgcaggtcacggctacggacgcggatgacgaagtgaac
acctacaacgccgccatcgcttacagcatcgccagccaagagcctatgctgcctcatgac
aaaatgttcaccatcaacagggacacaggagtcattagtgtgctcactactgggctggat
cgtgagagtttccccacgtacaccttggtggttgtagctgctgaccttcaaggtgaaggc
ttgagcacaagcgctaaagctgtgatcacggtcactgacaccaacgacaaccctcccatc
ttcaacccgaccacgtaccgtggtgaagttcctgagaatgaggctaatgttgtaatcact
acgctcaaagtgactgatgccgacgtccccaataccccagcatgggaggccgtgtacacc
atattaaatgacaatgaggagcaatttgttgtcaccacagacccagtaaccaacgatggc
attttgaaaacagctaagggcttggattttgaggccaagcagcagtacattctctatgtg
gcagtgaagaacgtggccccctttgaggtcactctgtccacctccacagccaccatcaca
gtggacgtgctggatgtgaacgaagcccccatcttcatgcctccccaaaagagagtggag
gtgtctgaagactttccagtgggactggaaatcacatcttacactgcccaggagccggac
acgtttatggaacagaagataacgtatcggatttggagggacactgccaattggctggag
gttaatccggacactggtgccatttccactcgggctaagatggacagagaggacgacaac
catgtgaagaacagcacgtacacggccctcatcatagccacggacaatggttctccggtt
gctactggaacgggaacccttctcctgatcctcactgatgtgaacgacaatgcccctata
ccagatcctcgaaatgtgaacttctgccagcataatccacagcctcatatcatcaacatc
attgatccagatcttccccccaacacatctcccttcactgcagaactaacacatggggca
agtgtcaactggaccattgagtataatgacccagaacatgaatctatcattttgaagcca
aagaaaaccttagagttgggttcctacaaaataaatctcaagctcgcagataaccagaac
aaagaccaggtgaccaccttagacgtgtatgtgtgtgactgtgaaggggccgtcaatggc
tgtaagaaggatgcagcttatgttgaagcaggattgcaggttcctgccattctggggatt
cttggaggcatccttgctttgctaatcttgattctgctgcttctgctgtttgttcggagg
agacgggtggtcaaagagcccttactgcccccagaagacgacactcgggacaacgtttat
tactacgatgaagaaggaggtggagaagaggaccaggacttcgacttgagccagttgcac
agaggtctggatgctcggcctgaagtgactcgcaatgatgtggcaccaaccctcctgagt
gtgccccagtatcggccccgccctgccaatcctgatgaaattggaaactttattgatgaa
aacttgaaggcggctgatagtgaccccactgctcccccttatgactctctgctcgtgttt
gattacgaaggaagtggttccgaagctgctactctgagctccctgaactcctcagaatca
gaccaagaccaggactacgactacctgaatgaatggggcaatcgcttcaagaagttggca
gatatgtatggaggtggcgaggatgactag

DBGET integrated database retrieval system