KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520689
Entry
107520689         CDS       T06036                                 

Gene name
RARA
Definition
(RefSeq) retinoic acid receptor alpha isoform X1
  KO
K08527  retinoic acid receptor alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04659  Th17 cell differentiation
ray04915  Estrogen signaling pathway
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107520689 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107520689 (RARA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520689 (RARA)
   05202 Transcriptional misregulation in cancer
    107520689 (RARA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107520689 (RARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107520689 (RARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107520689 (RARA)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    107520689 (RARA)
Nuclear receptors [BR:ray03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   107520689 (RARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 107520689
NCBI-ProteinID: XP_016020223
LinkDB
Position
Unknown
AA seq 462 aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPSMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccaacacctgggggagggcacctcaatgggtacccg
gtgcccccctacgccttcttcttcccgtctatgctgggcggactctccccaccaggcgcc
ctgaccactctccagcaccagcttccagtcagtggctacagcacaccctccccagccacc
attgagacccagagcagcagttctgaagagatagtgcccagtcctccctcaccgcccccc
ctcccccgcatctacaagccttgctttgtctgtcaagacaaatcctcaggctaccactat
ggggtcagcgcctgtgagggctgcaagggcttcttccgtcgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccgcaaccgttgc
cagtactgccggctgcagaagtgcttcgaagtgggcatgtccaaagagtctgtgaggaat
gaccggaacaagaagaagaaggagacgcccaagcccgagtgctcggagagctacacgctg
acaccagaggtgggggagctcatcgagaaggtgcgcaaagcgcaccaggagaccttccct
gcactctgccagctgggcaaatacactacgaacaatagctcagaacaacgtgtttctctg
gacatcgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcaactgcctggcttcaccaccctcaccattgccgaccagatcaccctt
ctcaaagctgcctgcctggacatcctgatcctgcggatctgcacgaggtacacgcccgag
caggacacaatgaccttctcagatgggctgaccctgaaccggacccagatgcacaacgca
ggcttcggcccactcacagacctggttttcgccttcgccaaccagctgctgcccctggag
atggatgatgctgagaccgggctgctcagtgccatctgcctcatctgtggagaccggcag
gacctggagcagccagacagggtggacatgctgcaggagccgctgctcgaggcgctgaag
gtctatgtgcggaaacggaggcccagccgtccccacatgtttccaaagatgctgatgaag
atcacagacctgcgaagcatcagtgctaagggggctgagcgggtgatcacgctgaagatg
gagatcccgggctccatgccacctctcatccaggaaatgctggagaactcagagggcttg
gatactctgagtggacagccggggggtggagggcgggatggcggtggcctggccccaccg
cctggcagctgtagccccagcctcagccccagttcaaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system