KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520699
Entry
107520699         CDS       T06036                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04530  Tight junction
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05219  Bladder cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520699 (ERBB2)
   04012 ErbB signaling pathway
    107520699 (ERBB2)
   04066 HIF-1 signaling pathway
    107520699 (ERBB2)
   04020 Calcium signaling pathway
    107520699 (ERBB2)
   04151 PI3K-Akt signaling pathway
    107520699 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520699 (ERBB2)
   04520 Adherens junction
    107520699 (ERBB2)
   04530 Tight junction
    107520699 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520699 (ERBB2)
   05206 MicroRNAs in cancer
    107520699 (ERBB2)
   05205 Proteoglycans in cancer
    107520699 (ERBB2)
   05230 Central carbon metabolism in cancer
    107520699 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107520699 (ERBB2)
   05226 Gastric cancer
    107520699 (ERBB2)
   05219 Bladder cancer
    107520699 (ERBB2)
   05215 Prostate cancer
    107520699 (ERBB2)
   05213 Endometrial cancer
    107520699 (ERBB2)
   05224 Breast cancer
    107520699 (ERBB2)
   05223 Non-small cell lung cancer
    107520699 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107520699 (ERBB2)
   01524 Platinum drug resistance
    107520699 (ERBB2)
   01522 Endocrine resistance
    107520699 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107520699 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107520699 (ERBB2)
   04090 CD molecules [BR:ray04090]
    107520699 (ERBB2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107520699 (ERBB2)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   107520699 (ERBB2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   107520699 (ERBB2)
CD molecules [BR:ray04090]
 Proteins
  107520699 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 107520699
NCBI-ProteinID: XP_016020258
LinkDB
Position
Unknown
AA seq 1254 aa
MELAAWCRWGLLLALLPPGATGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDSYALAVLDNG
DPLDSATPAVGAAPGGLQELQLRSLTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNQLA
LMLIDNNRSRACQPCSPACKASHCWGESSKDCQRLTRTVCASGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREARAVTSAN
VLEFAGCKKIFGSLAFLPESFAGDPASSTAPLQPEQLRVFETLEEITGYLYISAWPETLP
DLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNAHLCFVHTV
PWDQLFRNPHQALLHSANRPEDECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVKDKYCLPCHPECQPQNGSVTCVGSGADQCVACAHYKDSPFCVARC
PSGVKPDLSFMPIWKFPDEKGTCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
TLLVMIIGVVFGILIRRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPVPGAGGTAHRRHRSSSTRSGGGELTLGLEPSEEEPPKSPLAPSEG
AGSDVFDSDLGVGAAKGLQTLSPHDPSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEARPQPPSPLDGPPTPRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPRG
KAASQPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDVPV
NT seq 3765 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctccttctcgccctcctgccccccggagcc
acgggcactcaagtgtgcactggcacagatatgaagctgcggctcccagccagtcctgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcaggggaacctg
gaactcacctatctgcctgccaatgccagcctctctttcctacaggacatccaggaggtg
cagggttatgtgctcatcgctcacaaccaagtgagacaggtcccactgcagaggctgcga
atcgtgcgaggcacccagctatttgaggacagctatgccctggccgtgctggacaatgga
gaccctctggacagtgccacccctgctgttggggctgccccaggaggactgcaggagctg
cagctgcgaagcctcacagagatcctgaagggaggggtcttgatccagcggaaccctcag
ctctgccaccaggatacgattttgtggaaggacatcttccacaagaacaaccagctggcc
ctcatgctgatagacaacaaccgctcccgggcctgccaaccctgttctccagcttgtaaa
gcctctcactgctggggagaaagttccaaggattgtcagcgcttgacgcgaactgtctgt
gccagtggctgtgcccgatgcaagggcccgctgcctaccgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacggacaccttcgag
tccatgcccaaccctgagggccggtatacctttggtgccagctgtgtgaccgcctgtccc
tacaactacctatcgacggacgtgggatcctgcaccctagtctgtccccttaacaaccaa
gaagtgacagctgaagatggaacacagcggtgtgagaaatgcagcaagccttgtgcccga
gtgtgctatggcctgggcatggaacacctgcgggaggcaagggcggtcactagtgccaat
gtcctggagtttgctggctgcaagaagatctttgggagcctggcgtttctgccggagagc
tttgcgggggacccagcctccagcactgcccccctacagcctgagcagctcagagtgttt
gagaccttagaggaaattacaggttacctgtacatctcagcgtggccagaaaccctgcct
gacctcagtgtcttccagaacctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaaggcctgggcatcagctggctggggctgcgctcactgcgggaa
ctgggtagtgggctggccctcatccaccgcaacgcccacctctgctttgtgcacacggtg
ccctgggaccagctctttcggaaccctcaccaggccctgctccacagtgctaaccgacca
gaggacgaatgtgtgggtgaaggcctggcctgctacccgctgtgtgcccatgggcactgc
tggggtccgggacccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggagtgccgagtactgcaggggctcccccgggagtatgtgaaggacaagtactgt
ctgccgtgccaccccgagtgtcaaccccagaatggctcagtgacctgcgtaggatcgggg
gctgaccagtgtgtggcctgtgcccactacaaggactctcccttctgcgtggctcgctgc
cccagtggtgtgaaacctgacctctccttcatgcccatctggaagttcccagatgagaag
ggcacgtgccagccgtgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccctgctgagcagagagccagccctgtgacgtccatcattgctgctgtggtggga
actctgctggtcatgattataggggtagttttcggcatcctaatcaggcgaaggaggcag
aagatccggaagtacacgatgagaaggctgctgcaggaaacagagctggtggagccgttg
acacctagtggagcaatgcctaaccaggctcagatgcggatcctaaaagagacagagctg
aggaaggtgaaggtgcttggatcaggagcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatct
cccaaagccaacaaagaaatcctggacgaagcatatgtgatggctggtgttggctcccca
tatgtgtcgcgcctcctgggcatctgcctgacctctaccgtgcagctggtgacacagctt
atgccctatggctgcctcctagaccatgtccgggaacaccgtggacgcctgggctcccag
gacctgctgaactggtgtgtgcagattgcaaaggggatgagctacttggaggaagtgcgg
cttgtgcacagggacctggctgcccggaatgtgctggtcaagagtcccaaccatgtcaag
atcacagactttgggctggctcggctgctggacattgacgagacagagtaccatgcggat
gggggcaaggtacccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctacggtgtgactgtatgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccatcgatgtctacatgatcatggtcaaatgttggatg
attgactccgagtgtcggcctcggttccgggagttggtggccgaattctcccgcatggcc
agggatccccagcgctttgtggtcatccagaatgaggatctgggccctgccagccccttg
gacagcaccttctaccgctcgctgctggaggatgacgacatgggggacctggtggatgcg
gaggagtacctggtaccccagcagggcttcttctgcccagatcctgttccgggtgctggg
ggcacagcccaccgcaggcaccgcagctcatccaccaggagtggcggtggtgagctgaca
ctggggctggagccctccgaagaggagccccccaagtctccactggcaccttcagaaggg
gcaggctctgatgtgtttgacagtgatttgggagtgggggcagccaagggactgcaaact
ctctccccacatgaccccagccctctacagcggtacagtgaggaccccacagttcccttg
cctcctgaaactgatggctacgttgctcccctgacctgcagcccccagcccgaatacgtg
aaccagccagaggctcgcccgcagcctccctcacccctagatggccccccgactcctcga
cctgctggtgccacgctggaaaggcccaagacactctctcctgggaagaacggggttgtc
aaagatgtttttgcctttgggggtgctgtggagaaccccgagtacttggcaccccgtggc
aaggctgcttcacagccccaccctcctccagccttcagtccagcttttgataacctctat
tactgggaccaggacccatcagagcggggttctccacctagcacctttgaagggacccct
acggcagagaaccctgagtacctgggcctggatgtgccagtgtga

DBGET integrated database retrieval system