KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520741
Entry
107520741         CDS       T06036                                 

Gene name
PARD3
Definition
(RefSeq) partitioning defective 3 homolog
  KO
K04237  partitioning defective protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04144  Endocytosis
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04530  Tight junction
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107520741 (PARD3)
   04390 Hippo signaling pathway
    107520741 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107520741 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107520741 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107520741 (PARD3)
   04530 Tight junction
    107520741 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107520741 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    107520741 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107520741 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107520741 (PARD3)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107520741 (PARD3)
SSDB
Motif
Pfam: PDZ Par3_HAL_N_term PDZ_2 PDZ_6
Other DBs
NCBI-GeneID: 107520741
NCBI-ProteinID: XP_016020333
LinkDB
Position
Unknown
AA seq 1424 aa
MALHVKEASGMDWCVDWRVVQWGEDVASWMLDRWSLSSDQHLWEAGPASQGWPRAFHFML
LFWGLAAVPALTRMNALSCVPSASTDLVCCQLRSTLCWYRGKRGCSKREVLQDPSYWIQV
HRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSEL
GTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALVGLSTSVSDSNFSSEEPSRK
NPTRWSTTAGFLKQNTAGSPKACDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPM
VDKWLEKQEQDEDGTEEDNSRVEPVGHADTSLENIPSFSLDDMVKLVHVPNDGGPLGIHV
VPFSARGGRTLGLLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFDQAQHMFRQAM
RTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDSRGVNSAGLQTLQRAPRL
SHPAEQVDAHPRLPQSTQPSGKPPSAPAPQNSFSTNVSSGYNTKKIGKRLNIQLKKGTEG
LGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSL
LRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDVVLTPDGTREFLTFE
VPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESL
LGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPSGPELPIETVLDDR
ERRISHSLYSGIEGLDESPTRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVPPPHL
SDQSSSSSHDDVGFVPTDPGPWAKAAVSDSADCSLSPDVDPALAFQREGFGRQSMSEKRT
KQFSDASQLDFVKTRKSKSMDLGIADETKLSTVDDQKAGSPSRDVGPSLGLKKSSSLESL
QTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPTVDDDDEGMETLEEDTE
ESSRSGRESVSTASDQPSHSLERQINGNQEKGDKTWRKDKTGKEKKKERDKEKDKMKAKK
GMLKGLGDMFRFGKHRKDDKIEKTGKIKIQDSLTSEEERIRMKQEQERIQAKTREFRERQ
ARERDYAEIQEFHRTFGCDDELMYGGISSYKGSIALNARPQSPREGHMMDALYAQVKKPR
NSKPSPADSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNSRPAAQSGR
HSVSVEVQMQRQRQEERESFPQAQRQYSSLPRQSRKNASSVSQDTWEQNYAPGEGFQSAK
ENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPPPPEGLNNYDS
YKKVQDPTYSAPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 4275 nt   +upstreamnt  +downstreamnt
atggctctccacgtgaaagaggccagtggtatggactggtgtgtggactggcgtgttgtg
cagtggggggaagatgttgcctcctggatgttggatagatggagcctcagctcagaccag
cacctctgggaggctggccctgcctcccaaggctggccgcgggccttccacttcatgctt
ctcttctggggactagctgcagtgcctgcactgacccggatgaatgcgctctcctgtgta
cccagcgctagcacggatcttgtgtgttgccagctccgctcaacattatgctggtaccgg
gggaaaagaggatgcagtaaaagagaagtgctgcaggacccaagctactggatacaggtg
catcgactggaacatggagatggaggaatactggatctcgatgacattctctgtgatgta
gcagatgataaagacagactggtagcggtgtttgatgagcaagatccacatcatggcggc
gatggcaccagtgccagctccacgggcacccagagtccagagatatttggcagtgagctt
ggcaccaacaatgtttcagcctttcagccttatcaagcaacaagtgaaattgaggtcaca
ccttcagtccttcgtgcaaatatgcctcttcatgtccgacgaagcagtgacccagcttta
gttggcctctcaacttctgtcagtgatagcaatttttcctctgaagagccttcacgaaaa
aaccccacacgctggtcaacaacagcgggctttctcaagcagaacactgccggtagccct
aaagcctgtgataggaagaaagatgaaaactacagaagtcttccacgggataccagtaac
tggtcaaaccagtttcagagagataatgctcgctcatctctgagtgccagtcacccgatg
gtggacaagtggctggagaagcaagaacaggatgaggatgggacagaagaagacaacagc
cgtgttgaacccgttggacatgctgacactagtttggaaaacatacccagcttttctctg
gatgatatggtaaagctcgtacacgtccccaacgatggagggcctctgggaatccatgta
gtgcctttcagtgctcgaggcggcagaaccctggggttattagtaaaacgattggagaaa
ggtggtaaagctgaacaagaaaacctttttcatgagaacgattgcattgtcaggattaat
gatggcgaccttcgaaatagaagatttgatcaagcacaacatatgtttcgccaagccatg
cgtactcccatcatttggttccatgtggttcctgcagcaaataaagagcagtacgaacaa
ctctctcaaagtgagaagaacaattactactcaagccgcttcagccctgacagccagtat
attgatagcaggggcgtgaacagtgcagggctccagacactgcagagagcgcccagactg
tcccacccggccgagcaggttgatgctcacccacgactacctcagagcacacagccctct
ggaaaaccgccgtcagctccagctccacaaaattcatttagtacaaatgtaagcagtggt
tataataccaaaaaaataggcaaaaggcttaatatccagcttaagaaaggtacagaaggt
ttgggattcagcatcacttccagagatgtaacaataggtggctcagctccaatttatgtg
aaaaacatccttcccagaggagctgccatccaggatggccgacttaaggcaggagatcga
cttatagaggtaaatggagtagatttagcaggcaaatcccaagaggaagttgtttccctg
ttgagaagtaccaagatggaagggactgtgagccttttggtgtttcgccaagaagatgcc
ttccacccaagggaactgaatgcagagccaagccagatgcagattccaaaagaaacgaaa
gcagaagatgaggatgttgttctcacacctgatggcaccagggaatttctgacatttgaa
gttccactaaatgattctggatcagctggtcttggtgtcagtgtcaaaggtaaccggtca
aaggagaaccatgcggatttgggaatctttgtcaagtccattattaatggaggagcagca
tctaaagatggaaggcttcgggtgaatgatcagctgatagccgtgaatggagagtccctg
ttgggcaagacaaaccaggacgccatggaaaccctcagacggtccatgtccaccgaaggg
aacaagcgaggaatgatccagctcattgttgcaaggcgaataagcaaatgcaatgagctg
aagtcacctgggagcccctctggacctgagctgcccattgaaacagtgttggatgacaga
gaacgaagaatttcccattccctctatagtgggattgagggactggatgaatcacccaca
agaaatgctgcactcagtaggataatgggtaaataccagctgtcccccacagtgaatatg
ccccaagatgacactgtcattattgaagatgacagattgcctgtgcctcctccacatctc
tctgaccagtcgtcttccagctcgcacgatgatgtggggttcgtgccgacagaccccggc
ccctgggctaaggctgcagtcagtgattcagcagattgctctttgagtccagatgttgat
ccagctcttgcttttcaacgagaaggatttggacgccagagtatgtcagaaaaacgcaca
aagcaattttcagatgccagtcaattggatttcgttaaaacacgaaaatcaaaaagcatg
gatttaggtatagctgacgagactaaactcagtacagtggatgaccagaaagcaggttcc
cccagcagagatgtgggaccttccctgggtctgaagaagtcaagctcattggagagtctg
cagacagcagttgccgaggtgactttgaatggagacattcctttccatcgcccacgacca
cggataatcagaggaaggggatgcaacgaaagcttcagggctgccatcgacaagtcttac
gataaacccacagtagatgatgatgatgaaggcatggaaacattggaagaagacacagaa
gaaagttcaagatcagggagagagtctgtgtccacagccagtgaccagccttcacattcc
ctggagaggcaaataaatggaaaccaagagaaaggtgataagacttggagaaaggataaa
actggaaaagagaagaagaaagaaagagataaggaaaaggataaaatgaaagccaagaag
gggatgctgaagggcctaggagacatgttcaggtttggcaaacatcgaaaagatgacaag
attgagaaaacgggtaaaataaaaatacaggactcccttacatcagaagaggagagaata
cgaatgaagcaggagcaggagaggattcaagccaaaactcgagaatttagagagcgacaa
gctcgagaacgtgactatgctgaaatccaagaatttcatcggacttttggctgtgatgat
gagttgatgtacgggggaatttcttcctacaagggttccattgctctcaacgccagaccc
cagagcccaagagaaggacatatgatggatgctttgtatgcccaagtgaagaagccacgg
aattccaaaccttcacctgcagacagcaacagatcaactcctagcaaccatgatcggata
cagcgtctacggcaagaattccagcaagcaaagcaggatgaagatgtagaagatcggaga
cgtacctacagctttgaacaaccgtggcctaactccaggccggcggcgcagagcggcaga
cactcggtgtccgtggaggtgcagatgcagcgccagcggcaggaggagcgcgagagcttc
ccgcaggcccagcgccagtacagctctctgcccaggcaaagcaggaaaaatgccagctct
gtctcccaggatacttgggagcagaactacgccccgggggaaggcttccagagtgccaag
gagaaccccaggtactccagctaccagggctccagaaacggctacctgggtgggcacggc
ttcaatgccagggtgatgctagagactcaggagctccttcgccaagagcagaggcgaaaa
gagcaacagatgaagaagcagccccctcctcctcccgaggggctcaacaactatgactca
tataagaaagtgcaggaccccacttacagtgctcccaaggggcccttccggcaagacgtg
cccccgtccccttctcaggtcgctaggctgaacagactgcagactcctgagaaagggagg
cccttctattcctga

DBGET integrated database retrieval system