KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520743
Entry
107520743         CDS       T06036                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107520743 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107520743 (CREM)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107520743 (CREM)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 107520743
NCBI-ProteinID: XP_016020341
LinkDB
Position
Unknown
AA seq 375 aa
MREMNIRKIGKNRNVSDRTLIFLPFYCLFRQMTMETIESQQDGSITDSVAESESAHMQTQ
TGQNSIPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVHVQGVIQTPQPSVIQSPQIQTVQ
VATIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVHGVPKIEEEKSEEEGTP
PNIATMAVPTSIYQTSTGQYIAIAQGGAIQISNPGSDGVQGLQALTMTNSGAPPPGATIV
QYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMA
ASPGSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLI
EELKALKDLYCHKAE
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagagaaatgaatatcagaaagataggtaaaaacagaaatgtttcagataggacctta
atatttcttcctttttattgtcttttcagacaaatgaccatggaaacaattgaatctcag
caggatggaagtataacagattctgtggcagagagcgaatctgctcatatgcagacccag
actggtcaaaattcaattcctactttagctcaggtttctgtagctggatcaggcaccgga
agaggctccccagctgtaactctagtacagttaccttcaggccagactgtacatgtccag
ggagtaattcagacaccacagccatcggttattcagtcaccacaaatacaaactgttcag
gtagcaacaattgcagagacagatgagtctgcagaatcagaaggtgtaattgattctcat
aaacgtagagaaatcctttcacgaagaccctcttatcgaaaaatactgaatgaactttct
tctgatgtgcatggtgttcccaagattgaagaagaaaaatcagaggaagaaggaacacca
cctaacatcgctaccatggcagtaccgactagcatatatcagactagcacggggcaatac
attgctatagcccaaggtggagcaatccagatttctaacccaggatctgatggtgttcag
ggactacaggcattaacaatgacaaattcaggagctcctccaccaggtgctacaattgta
cagtatgcagcacagtcagctgatggcacacagcagttctttgtcccaggcagccaggtt
gttgttcaagatgaggaaactgaacttgccccaagtcacatggctgctgccactggtgac
atgccaacttaccagatccgagctcctactactgctttgccacagggagtagtgatggct
gcctcaccaggaagtttgcacagcccccagcaactcgcagaagaagccacacgtaaacga
gagctgaggctaatgaaaaacagggaagctgcccgggagtgtcgcaggaagaagaaagaa
tatgtcaaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaaaacaagactctcatt
gaggaactcaaggccctcaaagatctttattgccataaagcagagtaa

DBGET integrated database retrieval system