KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520925
Entry
107520925         CDS       T06036                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04110  Cell cycle
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05212  Pancreatic cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107520925 (RB1)
   04218 Cellular senescence
    107520925 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520925 (RB1)
   05203 Viral carcinogenesis
    107520925 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107520925 (RB1)
   05225 Hepatocellular carcinoma
    107520925 (RB1)
   05226 Gastric cancer
    107520925 (RB1)
   05214 Glioma
    107520925 (RB1)
   05220 Chronic myeloid leukemia
    107520925 (RB1)
   05218 Melanoma
    107520925 (RB1)
   05219 Bladder cancer
    107520925 (RB1)
   05215 Prostate cancer
    107520925 (RB1)
   05224 Breast cancer
    107520925 (RB1)
   05222 Small cell lung cancer
    107520925 (RB1)
   05223 Non-small cell lung cancer
    107520925 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107520925 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520925 (RB1)
   05161 Hepatitis B
    107520925 (RB1)
   05160 Hepatitis C
    107520925 (RB1)
   05163 Human cytomegalovirus infection
    107520925 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520925 (RB1)
   05169 Epstein-Barr virus infection
    107520925 (RB1)
   05165 Human papillomavirus infection
    107520925 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107520925 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107520925 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107520925 (RB1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107520925 (RB1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    107520925 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 107520925
NCBI-ProteinID: XP_016020671
LinkDB
Position
Unknown
AA seq 894 aa
MPPKAPRRAAAASAAAPPAPPPPPPPAEEDPEQDSGPEDLPLARLEFEETEEPDFTALCQ
KLKIPDHVRERAWLTWEKVSSVDGVLESYIQKKKELWGICIFIAAVDLDEMPFTFTELQK
NIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYDVLCALYSKLERTCEFIYLTQPSSLIS
TEINSMSVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLREPYKTA
VIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNS
LGIVASNGLPEVENLSKQYEEIYFKNKDLDARLFLDHDKTLQADPTDRYCTWYICIFDML
LLYIVDIDFCFSFLKNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCIEIGSQRYKLGV
RLYYRVMESMLKSEEERLSIQNFSKLLNDNTFHMSLLACALEVVMATYSRSTSQNLDTGT
DLSFPWILNVFNLKAFDFYKVIESFIKAEANLTRDMIKHLERCEHRIMESLAWLSNSPLF
DLIKQVKDREGPADHLESACTLNLSLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAES
QATSAFQTQKPLKSTCLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQN
EYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYD
SIIVFYNSVFMQKLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLK
NPEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKK
LRFDIEGTDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMNISDREEK
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccccggagagcagccgccgcctccgccgccgcacccccggcaccg
ccgccgccgccaccccctgctgaggaagaccccgaacaggacagtggccccgaggacctg
cctctggccaggcttgagtttgaagaaactgaagaacctgattttactgcgttatgtcag
aaattaaagataccagatcatgtcagagaaagagcttggttaacttgggagaaagtttca
tctgtggatggagtattggaaagttatattcaaaagaaaaaggaactatggggcatctgt
atctttattgcagcagttgacctagatgagatgccgtttacttttactgagctacagaaa
aacatagaaacaagtgtctataaattctttgacttactaaaagaaattgatactagtacc
aaagttgacaatgctatgtcaagactattgaagaagtacgatgtattgtgtgcactctac
agcaaactggaaaggacatgtgaatttatatatttgacacaaccaagcagtttgatatct
actgaaataaattctatgtcggtgctaaaagtttcttggatcacatttttactagctaaa
ggggaagtattacaaatggaagatgatcttgtaatctcatttcagctaatgctgtgtgtc
cttgactattttatcaaactttcaccacctgcattactcagagaaccatataaaacagct
gtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacaggagtgcacgg
atagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaa
tgtaatatagatgaggtgaaaaacgtttatttcaaaaattttataccttttatgaattct
cttggaattgtagcttctaatggacttccagaggtggaaaatctctctaaacaatatgaa
gaaatttattttaagaataaagatctagatgcaagattatttctggatcatgataaaact
cttcaggctgatcctacagacaggtattgtacatggtatatttgtatttttgatatgctt
ttgctatatatcgttgacattgatttctgtttctccttcttaaagaactgcacagtgaat
ccaaaagaaagtatcctgaagagagtaaaggatattggatatatctttaaagaaaaattt
gctaaagctgtgggacagggttgcatagaaattggatcacagcgatacaaacttggagtt
cgattgtattaccgagtaatggaatctatgctcaaatcagaagaagaacgattatccatt
caaaattttagcaaactcctgaatgacaacacctttcatatgtctttgttggcatgtgcc
cttgaagttgtaatggctacatatagcagaagtacatctcaaaatcttgatactggaaca
gatttgtccttcccatggattctgaatgtgtttaatttaaaagcctttgatttttacaaa
gtgattgaaagttttatcaaagcagaagccaacttgaccagagatatgataaaacattta
gaacgatgtgaacatcgaatcatggaatcccttgcatggctctcaaattcacctttattc
gatcttattaaacaagtgaaggaccgagaaggaccagctgatcaccttgaatctgcttgt
actctcaacctttctctccagaataatcatactgcagcagatatgtatctttctcctgta
aggtccccaaagaaaaaagggtcaactacacgtgttaattctactgcaaatgcagagtca
caagcaacctcagccttccagactcagaagccattgaaatctacctgcctttcactcttt
tacaaaaaagtgtaccgactagcatatcttcgactaaataccctgtgtgcgcgccttctg
tctgaccacccagaactagaacatatcatctggacccttttccagcacacattgcaaaat
gaatatgaactcatgagagacaggcatttggaccagattatgatgtgttccatgtatggc
atatgcaaagtgaagaatatagaccttaaattcaaaatcattgtaacagcttacaaggat
cttcctcatgctgttcaggagacattcaaacgggttttgatcagagaagaggagtatgat
tctattatagtattctataactcagtcttcatgcagaaactaaaaacaaatattttgcag
tatgcttccaccaggccccctaccttgtcaccaatacctcacattcctcgaagcccttac
aagttttctagttcacctttacggattcccgggggaaacatctatatatcacccctgaag
aatccagaaggtctgccaacgccaacaaaaatgactccaagatcaaggatcttagtatca
attggtgaatcatttgggacttctgagaagtttcagaaaataaatcagatggtgtgtaac
agtgaccgagtgctcaaaagaagtgctgaaggaagcaatcctcctaaaccactgaaaaaa
ctacgctttgacattgaaggaaccgatgaagcagatggaagtaaacatctcccaggagag
tctaaatttcaacagaaactggcagaaatgacatctactcgaacaagaatgcaaaagcag
aaaatgaatgatagcatgaatatctcggacagggaagaaaaatga

DBGET integrated database retrieval system