KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520981
Entry
107520981         CDS       T06036                                 

Gene name
PPP1R14A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 14A
  KO
K12328  protein phosphatase 1 regulatory subunit 14A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107520981 (PPP1R14A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107520981 (PPP1R14A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107520981 (PPP1R14A)
SSDB
Motif
Pfam: PP1_inhibitor
Other DBs
NCBI-GeneID: 107520981
NCBI-ProteinID: XP_016020781
LinkDB
Position
Unknown
AA seq 147 aa
MAAQRLGKRVLSKLQAPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
EELYCGREADMPDEVNIDELLELESEEDRSRKIQGLLKSCVNPTEDFVQELLVKLRGLHK
QPGLHQPSPSGDRSLSPLQDRARTAPP
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcagctcagcggctgggcaagcgggtgctgagcaagctgcaggctccgtctcgggcc
cgtgggccggggggcagccctgggggtctacagaaacgacacgcacgtgttaccgtcaag
tacgaccggcgggagctgcagcggcggctggacgtggagaaatggatcgacgggcgcttg
gaggagctgtactgcggcagggaagcagacatgccagatgaggtcaacattgatgaactg
ctggaactagagagtgaagaggaccgaagccggaaaatccagggactcctgaaatcctgc
gtgaaccctacggaggacttcgtccaggagctgctggtgaagctgcggggcctccacaag
cagccaggtctccaccagcccagcccctctggtgaccgaagcctgagccccctccaggac
cgggcccggaccgcgccaccctga

DBGET integrated database retrieval system