KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521255
Entry
107521255         CDS       T06036                                 

Gene name
ERBB3
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107521255 (ERBB3)
   04012 ErbB signaling pathway
    107521255 (ERBB3)
   04020 Calcium signaling pathway
    107521255 (ERBB3)
   04151 PI3K-Akt signaling pathway
    107521255 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107521255 (ERBB3)
   05205 Proteoglycans in cancer
    107521255 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107521255 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107521255 (ERBB3)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107521255 (ERBB3)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   107521255 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like SKG6 DUF4381
Other DBs
NCBI-GeneID: 107521255
NCBI-ProteinID: XP_016021273
LinkDB
Position
Unknown
AA seq 1338 aa
MRANAVLQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSILPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAAIVVKDNG
RNCPLCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNITSLGLRSLKEISAGRIYISANRQLCYHHSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPAQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHDDECFSCHPECRPMEGTATCNGSGSDACVQCAHFRDGPHCVSSCPYGVLGAKGPI
YKFPDAQNECRPCHENCTQGCKGPDLQDCLGQTPPLISKTHLAMALAVVVGLVVIFVILG
STILYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGAGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGAEPPALTNKELEEVELEPELDLDLDFEAEED
NLVTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQNNLGEACQESAVCGGSERCPRP
ASLHPLPRGRLVSESSEGHVTGSEAELQEKVSTCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPLSSPGLEEEDVNGYVMPDAHLKGTPSSREGTLSSVGLNSVLGTEEEDEDEEYEYMNRR
RHSPPRPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHSVPIMPTAGTTPDEDYEYMN
KRRGGGGSGGDYAAMGACPAAEQGYEEMRAFQGPGHHAPHVHYARLKTLRSLEATDSAFD
NPDYWHSRLFPKANTQRT
NT seq 4017 nt   +upstreamnt  +downstreamnt
atgagggcgaacgcggttctgcaggtgctgggcttccttctcagcctggcgcggggctcc
gaggtgggcaactcgcaggcagtgtgtcctgggactctgaatgggctgagtgtgactggc
gatgctgagaaccaataccagacattgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctcgagattgtgctcacaggacacaatgctgacctctctttcctgcagtggatc
cgagaagtgactggctatgtcctcgtggccatgaatgagttctctatactgcctctgccc
aacctccgagtggtacgggggacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactataacaccaactccagccatgctctccgccagctccgctttacacaactcact
gagattctgtctgggggtgtttatattgagaagaatgataaactttgtcacatggacaca
attgactggagggacatcgtgagggaccgagatgctgcgatagtggtgaaggacaacggc
aggaactgtcccctctgtcatgaggtctgcaaggggcgatgctggggtcctgggccagaa
gactgccagacattgaccaagaccatctgtgcccctcagtgtaatggtcattgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgcagggggctgctcaggccctcaggac
acagactgctttgcctgccgactcttcaatgacagtggagcctgtgtacgccagtgtcca
cagcctcttgtctacaacaagctaactttccagctggagcccaatcctcataccaagtat
caatatggaggagtttgtgtagcaagctgtccccataactttgtggtggatcaaacgtct
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatatgt
gaaccttgtgggggtctgtgccccaaagcctgtgaagggacgggctcggggagccgcttt
cagactgtggactctagcaacattgatggatttgtgaactgcaccaagattctgggcaac
ctggactttctcatcactggcctcaatggagacccctggcacaagatccctgccctggac
cctgagaagctcaatgtcttccggacagtacgggagattacaggttacctgaacatccag
tcctggcctccccacatgcataacttcagtgtcttttccaacctgacaaccatcgggggc
agaagcctctacaaccggggattctcgttattgattatgaagaacttaaatataacatct
ctgggcctccgatccttaaaagaaattagtgctgggcgtatctacataagtgccaatagg
cagctctgctaccaccattctctgaattggaccaggctgcttcgagggccttcagaagag
agactagacatcaagcataatcgaccccgcagagactgtgtggcagagggcaaagtgtgt
gacccactatgctcctctgggggatgctggggcccaggccctgctcagtgcctatcctgt
cgaaactacagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgcgagtttgcccatgatgatgaatgcttctcctgccacccagaatgccgtcctatggag
ggcactgccacatgcaatggctcgggctctgatgcttgtgtccagtgtgcccattttcga
gatgggccccactgtgtgagcagctgcccctatggagttctgggtgccaagggccccatc
tacaagtttccagatgctcagaatgaatgtcggccctgtcatgagaactgcacccagggg
tgtaagggaccagacctgcaagactgtttaggccaaacaccgccacttatcagcaaaacc
catctggcaatggctttagcagtggtagtaggattggtagtgattttcgtgatcctgggc
agcactattctttattggcgtgggcgccggattcagaataagagggctatgaggcgctac
ttggaacggggtgagagcatagagcctctggatcccagtgagaaggctaacaaagtcttg
gccagaatcttcaaggaaacagagctgaggaagcttaaagtgcttggtgcaggcgttttt
ggaactgtgcacaaaggagtgtggattcctgagggtgaatcaataaagattcctgtctgc
attaaagtcattgaggacaagagtggacggcaaagttttcaagctgtgacagatcatatg
ctggccattggcagcctagaccatgcccacattgtacggctgctaggactgtgcccaggg
tcatctctgcagcttgtcactcaatatttgcctctgggttccttgctggatcatgtgaga
caacaccggggggcactggggccacagttgctgctcaattggggagtacaaattgccaag
ggtatgtactaccttgaggagcatggtatggtgcataggaacctagctgcccgaaatgtg
ctacttaagtcacccagtcaggttcaggtggcagattttggggtggctgacctgctgccc
cctgatgataaacagctactacacagtgaggccaagactccaattaagtggatggccctt
gagagtatccactttgggaaatacacacaccagagtgacgtctggagctatggtgtgact
gtctgggaactgatgacctttggggcagagccctatgcagggctgcgattggctgaagta
ccggacctgctggagaagggggagcggttggcacagccccagatctgtaccattgatgtc
tacatggtcatggtcaagtgttggatgattgacgagaacattcgcccgacctttaaagag
ctagccaatgagtttaccaggatggcccgagacccaccacggtatctagttataaaaaga
gagagtgggcctggaattgcccctggggcagagccccctgctctgacaaataaggaactg
gaggaagtagagctagagccagaactagacctagacctggacttcgaggcagaggaggac
aacctggtgacaacactaggctctgccctcagtctgccagttggaacacttaatcggcca
cgtgggagccagagccttttaagtccatcatctggatatatgcctatgaaccagaataat
cttggggaggcttgccaggagtctgcagtttgcggaggcagtgaacgatgcccccgtcca
gcctctctgcacccattgccacggggacgcctggtatcagagtcatcagagggccatgtg
acaggctctgaggctgagctccaggaaaaagtgtcaacgtgtagaagccggagccggagc
ccacgaccacgtggagacagtgcctaccattcccagcgccacagcttgcttactcctgtc
actccactctcctcaccagggttagaggaagaggatgtcaatggttatgtcatgccagat
gcacatctcaaaggtactccttcctcccgggagggcactctttcttccgtgggtctcaat
tctgtcctgggtaccgaagaagaagacgaagatgaagagtatgaatacatgaaccggaga
aggcacagtccacctcgtccccctaggcccggttcccttgaggagctggggtatgagtac
atggatgtgggatcagacctcagtgcttccctgggcagcacacagagttgcccactccac
tctgtgcccatcatgcccactgctggcacaactccagatgaggactatgaatatatgaat
aagcgacgtggtggtggaggttctgggggagattatgcagccatgggggcctgcccagca
gctgagcaagggtatgaagaaatgagagctttccaagggcctggacaccatgccccccat
gtccattatgcccgcctcaaaactctacgtagtttagaagctactgactctgcctttgat
aaccctgattactggcacagcaggcttttccccaaggctaatacccagagaacataa

DBGET integrated database retrieval system