KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521282
Entry
107521282         CDS       T06036                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04914  Progesterone-mediated oocyte maturation
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
ray05222  Small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107521282 (CDK2)
   04151 PI3K-Akt signaling pathway
    107521282 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107521282 (CDK2)
   04114 Oocyte meiosis
    107521282 (CDK2)
   04115 p53 signaling pathway
    107521282 (CDK2)
   04218 Cellular senescence
    107521282 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107521282 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521282 (CDK2)
   05203 Viral carcinogenesis
    107521282 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    107521282 (CDK2)
   05215 Prostate cancer
    107521282 (CDK2)
   05222 Small cell lung cancer
    107521282 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107521282 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521282 (CDK2)
   05161 Hepatitis B
    107521282 (CDK2)
   05160 Hepatitis C
    107521282 (CDK2)
   05162 Measles
    107521282 (CDK2)
   05169 Epstein-Barr virus infection
    107521282 (CDK2)
   05165 Human papillomavirus infection
    107521282 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107521282 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ray03032]
    107521282 (CDK2)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521282 (CDK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107521282 (CDK2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107521282 (CDK2)
DNA replication proteins [BR:ray03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    107521282 (CDK2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107521282 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 107521282
NCBI-ProteinID: XP_016021318
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALTHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaactttcaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaagctgactggagaagtggtggcgcttaaaaaaatccgcttggacactgag
acagagggtgtacccagtactgcgatacgagagatctctctacttaaggaacttaaccac
cctaatattgtcaagttgctggatgtcatccacacagaaaacaaactctacttggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgctcttactggtattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagctttctgccattct
catcgggtcctgcaccgagatctcaaacctcagaatctgcttatcaacgcagaggggtcc
atcaagctagcagactttggactagccagagcttttggagtccctgttcgtacttacacc
catgaggtggtaaccctgtggtaccgagcacctgaaattcttctgggctgcaaatattat
tccacagctgtggacatctggagcctgggctgtatctttgctgagatgcacctagtgtgt
acccagcaccatgctaagtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccgccgggccctattcccaggagattctgagatcgaccaactc
ttccggatctttcggactctggggaccccagatgaggtcgtttggccaggagtcacttct
atgcctgattataaaccaagtttccccaaatgggcccggcaagattttagcaaagtagtg
cctcccctggatgaagatggaaggagcttgttatcgcaaatgctgcactacgaccccaac
aagcggatttcggcaaaggcagctctgactcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactctga

DBGET integrated database retrieval system