KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521286
Entry
107521286         CDS       T06036                                 

Gene name
MIP
Definition
(RefSeq) lens fiber major intrinsic protein
  KO
K09863  aquaporin-0
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107521286 (MIP)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107521286 (MIP)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107521286
NCBI-ProteinID: XP_016021326
LinkDB
Position
Unknown
AA seq 263 aa
MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQAVG
HISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNT
LHPGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTG
AGMNPARSFAPAILTRNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGT
RPSDSNGQPEGTGEPVELKTQAL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtgggaactgcggtcagcctccttctggagggccatatttgctgagttctttgccacc
ctcttctatgtcttcttcggactcggggcctcactgcgttgggcccctggacccctgcat
gtccttcaggtggcgctggcctttggcctggccctggctacgctggtgcaagctgtgggc
cacatcagtggagcccatgtcaatcctgcagtcacttttgccttccttgtgggctcccag
atgtccctactccgtgccttctgctatatggcagcccaactcctgggagccgtggctggg
gccgctgtgctgtatagtgttaccccgcctgccgtccgaggaaacctagctcttaacacg
ttgcaccctggggtgagtgtgggccaagccaccacagtggagatcttcctgacgctccag
ttcgtgctctgcatctttgccacatacgacgagaggcggaatggccgcatgggctctgtg
gccctggctgttggcttctccctcaccctggggcacctctttgggatgtattatactggt
gcaggcatgaaccctgcccggtcctttgctccagccattctcaccagaaacttcaccaac
cactgggtgtactgggtgggcccaatcattggagggggcctaggcagtctcctctacgac
tttctcctcttccctcggctcaagagtgtttctgagagactgtctattctcaagggtacc
aggcccagtgactccaatggacaaccagagggcacaggggaacctgttgaactgaagacc
caggccctataa

DBGET integrated database retrieval system