KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521319
Entry
107521319         CDS       T06036                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X1
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04020  Calcium signaling pathway
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04066  HIF-1 signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04072  Phospholipase D signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04750  Inflammatory mediator regulation of TRP channels
ray04919  Thyroid hormone signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107521319 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107521319 (PLCG2)
   04014 Ras signaling pathway
    107521319 (PLCG2)
   04370 VEGF signaling pathway
    107521319 (PLCG2)
   04064 NF-kappa B signaling pathway
    107521319 (PLCG2)
   04066 HIF-1 signaling pathway
    107521319 (PLCG2)
   04020 Calcium signaling pathway
    107521319 (PLCG2)
   04070 Phosphatidylinositol signaling system
    107521319 (PLCG2)
   04072 Phospholipase D signaling pathway
    107521319 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107521319 (PLCG2)
   04613 Neutrophil extracellular trap formation
    107521319 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    107521319 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    107521319 (PLCG2)
   04662 B cell receptor signaling pathway
    107521319 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    107521319 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    107521319 (PLCG2)
   04670 Leukocyte transendothelial migration
    107521319 (PLCG2)
   04062 Chemokine signaling pathway
    107521319 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107521319 (PLCG2)
   04919 Thyroid hormone signaling pathway
    107521319 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107521319 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107521319 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    107521319 (PLCG2)
   04380 Osteoclast differentiation
    107521319 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521319 (PLCG2)
   05206 MicroRNAs in cancer
    107521319 (PLCG2)
   05205 Proteoglycans in cancer
    107521319 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107521319 (PLCG2)
   05214 Glioma
    107521319 (PLCG2)
   05223 Non-small cell lung cancer
    107521319 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107521319 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107521319 (PLCG2)
   05171 Coronavirus disease - COVID-19
    107521319 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107521319 (PLCG2)
   05169 Epstein-Barr virus infection
    107521319 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107521319 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107521319 (PLCG2)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107521319 (PLCG2)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107521319 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107521319 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 107521319
NCBI-ProteinID: XP_016021370
LinkDB
Position
Unknown
AA seq 1265 aa
MTTMVNVDTLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKVVRQKEDCCFTILYGSQFVLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKAILPMVNFKVGSA
KFLKDKFVEIGAHKDELSFEQFHLLYKKLMFEQQKSIFDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRERMTRFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDIQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRYMARV
FKEVFGDLLLIKPTEASADQLPSPTQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEELPQDTPPTELHFGEKWFHKKVEKR
ISAEKLLQEYCSETGGKDGTFLVRESERFPNDYTLSFWRSGRVQHCRIRSTMEGGVMKYY
LTDNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRAKGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
HSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNQALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccaccatggtcaacgtggacacccttccggaatatgagaagagccagatcaagaga
gccctggagctgggcacggtgatgaccgtgttcagcttccgcaagtccaccccggagcgg
aggaccgtccaggtgatcatggagacgcggcaagtggcctggagtaagacggctgacaaa
atcgagggcttcttggatatcatggaaataaaggaaatccgccccgggaagaactccaag
gattttgagcgtgcaaaagtagtccgccagaaggaagactgctgttttaccatcttgtac
ggcagccagttcgtcctcagcacactcagtttagcagctgactctaaggaagatgcaact
aagtggctctctggcttgaagatcttacaccaagaagcgatgagtgcgtccacacccacc
attatcgagagttggctgagaaagcagatttattctgtggatcaaaccaggagaaatagc
atcagcctccgagagttgaaggccatcttgcccatggtcaatttcaaagtagggagtgcc
aagttcctcaaagataagtttgtggaaataggtgcacacaaagatgaactcagctttgaa
cagttccatctcctctataaaaagcttatgtttgaacaacaaaaatcgatttttgatgaa
ttcaaaaaagattcctccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gtccacctgcacgacttccagcggtttctcttacatgaacagcaggagctctgggctcag
gatctgaacaaagtccgtgagcggatgaccaggttcatcgatgacacgatgagggaaact
gccgagcccttcttgtttgtcgatgagttcctcacatacctgttttcacgggagaacagc
atttgggatgaaaagtatgacgtggtagacatacaggacatgaacaaccccttatcccat
tactggatctcctcatcacataacacgtaccttacaggtgaccagctgcggagcgagtca
tccacggaagcatacattcgctgtctgcgcatgggctgtcgctgcattgagctggactgc
tgggacgggcccgatgggaagcccatcatctaccatggctggacacggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcaagcttccct
gtgatcctgtccatcgaggagcactgttgcgtggagcagcagcgctacatggccagagtg
ttcaaggaggtgtttggcgacttgctgctgataaagcccacggaggccagtgcagaccag
ctgccctcgcccacgcagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggtgatgtagatgtcaacatggaggacaagaaagatgagcacaagcaacagggtgaa
ctgtacatgtgggattccattgatcagaaatggactaggcactactgcgccattgctgat
gccaagctatccttcagcgacgacattgaacagactatggaagaggagctaccccaggat
acaccccccacagaactgcattttggagagaagtggttccataagaaggtggagaagagg
ataagtgccgagaagctactgcaggaatactgcagcgagacggggggcaaagatgggacc
ttcttggtgcgagagagtgagaggttccccaacgactacaccttgtccttctggcggtct
ggccgggtccagcactgccggatccgctccaccatggagggcggagtcatgaagtactac
ctgactgacaacctcatgttcaccagcatctacgccctcatccagcactaccgtgagacg
cacctacggtgtgccgagttcgagctccggctcaccgaccccgtgcccaaccccaacccc
catgagtcaaagccgtggtactatgatgggctgagccgtggagaagcagaggacatgctg
atgagagttccccgggatggagccttcctcatccggaagcgagaaggtaccgactcctac
gccatcaccttcagggccaagggcaaggtgaagcactgtcgcatcaaccgggatggccgg
cactttgtgctggggacctccgcctactttgagagcctggtggaacttgtcagttactac
gagaagcacgcgctctaccgaaagatgaaactgcgctaccctgtgacccccgagctcctt
gaacgctacaatatggaaagagatataaactccctgtatgatgtcagcagaatgtatgtg
gatcccagtgaaatcaatccttctatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcagagtgatgagctgagcttttgccgtggtgctctcattcacaacgtctcc
aaggaacccgggggctggtggaaaggagactacggaaccagaatccagcagtacttcccg
tctaattacgtcgaggacatttcaacagtggatgtggaggagctggagaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatattggatctcaacacctataacgtt
gtgaaagccccacaagggaaaaaccagaagcctttcgtctttatcctggagcccaagaag
cagggtgaccctccggtggagtttgccacagacaaggtggaagagctctttgagtggttt
cacagcattcgggagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcgattgccatcgagctctcggacctggtcgtctactgcaaaccaacc
agcaagaccaaggacaatttagaaaaccccgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcgtcgtccgacagaaacccattgatctcctgaagtacaatctaaag
ggcctgacccgcgtttacccgaaggggcagagggtggactcctccaactatgatcccttc
cgcctctggctgtgtggctcccaaatggtggcgctcaatttccagacagcagataaatac
atgcagatgaatcaggccttgttttcactcaatgggcggactggctacgtcctacagcct
gagagcatgaggacggagaagtatgaccccatgccgcctgagtcccagcggaagatcctg
atgaccttgacggtcaaggttctcggggctcgacatcttcccaagcttggacgaagtatt
gcgtgtccctttgtggaggtggaaatatgtggagctgaatatgacaacaacaagtttaag
acaacggttgtgaatgacaatggcctaagccctgtttgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaaccttgcatttctgcgctttgtggtgtacgaggaagat
atgttcagtgatcccaacttcctggctcatgctacctaccccattaaaggaatcaaatca
ggatttagatctgttcctctgaagaatgggtacagcgaagacattgaactggcttccctc
ctggttttctgtgagatgcggccagtcctggagagtgaagaggaactgtactcctcctgt
cgccagctgcggaggcggcaagaagagctgaacaaccagctctttctatatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggtgaaagagttcaacgtcaacgagaac
cagctccagctgtatcaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttttactcatag

DBGET integrated database retrieval system