KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521325
Entry
107521325         CDS       T06036                                 

Gene name
SLC38A2
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 2 isoform X1
  KO
K14207  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04724  Glutamatergic synapse
ray04727  GABAergic synapse
ray04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    107521325 (SLC38A2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107521325 (SLC38A2)
   04727 GABAergic synapse
    107521325 (SLC38A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107521325 (SLC38A2)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107521325 (SLC38A2)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 107521325
NCBI-ProteinID: XP_016021379
LinkDB
Position
Unknown
AA seq 502 aa
MKKAEMGRFNISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETDFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGHKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIKAL
MNIEDTNGLWYLNGDYLVLLVSLVLILPLSLLRNLGYLGYTSGLSLLCMVFFLIVVICKK
FEIPCPLEVAWIANDLVNNTLIQPTAMAFNITDGDSCRPHYFIFNSQTVYAVPILTFSFV
CHPAVLPIYEELKGRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYERVESELLHTYSK
VLETDILILIVRLAVLVAVTLTVPVVIFPIRGSITHLLCPGKDFSWWRHSLITVSILAFT
NLLVIFVPTIRDIFGFIGASAAAMLIFILPSAFYIKLVKKEPMKSVQKIGAMFFLLSGIV
VMTGSMALIVLDWTHNTPGGGH
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaagaaagccgaaatgggaaggttcaatatttcccccgatgaggacagcagcagttac
agttcgaacagcgacttcaactactcctaccccaccaagcaagctgctctgaaaagccat
tatgcagatgtagatcctgaaaaccagaactttttacttgaatcgaatttgggaaaaaag
aagtatgaaacagattttcatccaggtactacttcctttggaatgtcagtatttaatctg
agcaatgcgattgtgggcagtggaatccttgggctttcttatgccatggctaatactgga
attgctctttttataattctcttgacatttgtgtcaatattttccctgtattctgttcat
ctccttttgaagactgccaatgaaggaggatctttgttatatgaacaattgggacataag
gcatttggattggttggaaagcttgcagcttctggatcgattacaatgcagaatattgga
gctatgtcaagctacctcttcatagtgaaatatgagttacctttggtgatcaaggcatta
atgaacattgaagatacaaatggattgtggtatctgaacggtgactatttggttctgctg
gtgtcgttggtgctcattcttcctttgtcactgctgagaaatttaggatatttgggatat
accagtggcctttccttgttgtgtatggtgttctttctgattgtggtgatttgcaagaaa
tttgagattccttgtcctttggaagttgcttggatagctaatgatttagtaaataacacc
ctcatacagccaacagccatggcatttaacataactgatggtgattcttgcagaccacat
tattttatcttcaactcacagaccgtctatgctgtgccaattctgaccttttcgtttgtc
tgccatcctgctgttcttcccatttacgaagagctgaaaggccgcagtcgcagaagaatg
atgaacgtgtccaagatttcattttttgctatgtttctcatgtacctgcttgctgccctc
tttggatacctgacattttatgaacgcgttgagtcagaattgcttcatacctactctaaa
gtcttggaaactgatattcttattctcattgttcgtttggctgtgttagtggctgtcacc
ctaacagtaccagttgttattttcccgatccggggttctataactcacttattgtgtcca
ggaaaagattttagttggtggcgtcatagtctcattactgtgtccatcttggcatttacc
aatttgcttgtcatctttgtcccaactataagagatatctttggtttcattggtgcatct
gcagctgctatgttgatttttattcttccatctgccttctatatcaagttagttaagaaa
gaacctatgaaatctgtacaaaagattggggctatgttcttcctgctgagtggcatagtg
gtgatgaccggaagcatggccttgattgttctggactggacacacaacactcctggaggt
ggccattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521329
Entry
107521329         CDS       T06036                                 

Gene name
SLC38A1
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 1 isoform X1
  KO
K14990  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04724  Glutamatergic synapse
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107521329 (SLC38A1)
   04727 GABAergic synapse
    107521329 (SLC38A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107521329 (SLC38A1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107521329 (SLC38A1)
SSDB
Motif
Pfam: Aa_trans Cation_ATPase_C
Other DBs
NCBI-GeneID: 107521329
NCBI-ProteinID: XP_016021403
LinkDB
Position
Unknown
AA seq 498 aa
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDDYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLILLSSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGEEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIRCDVPELNLTNSAANSTNADMCMPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSEL
KDRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYERVESNLLHKYHSKNDILILTVRLA
VIVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHISVTVILLVIINLLVIFIPSMKDIFG
VVGVTSANMLIFILPSSLYLKITNQDGDKGTQRIWVCLMPATLIFLISFSISICQINSRS
PPCDTTFNGLEGRQQSVL
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgatgcatttcaaaagtggactcgaattaactgagttgcaaaacatgacagtgcctgaa
gatgataacatcagcaatgattccaatgatttcacggaagtagaaaatggtcaaataaat
agcaagtttatttccgatcgtgaaagtagaagaagtctcacaaacagccatttggaaaaa
aagaaatgcgatgattatattccaggaacaacctccttaggcatgtctgtttttaaccta
agcaacgccatcatgggaagtgggattttgggactcgcctttgccctggcaaacaccgga
atcctactttttctgatactcttgtcttcagtgacactgctgtctatatattcaataaac
cttctgttgatctgttcaaaggaaacaggctgcatggtttatgaaaagctgggagaacag
gtctttggcaccacagggaagtttgtaatctttggagccacctctctacagaacactgga
gcaatgctgagctacctcttcatagtaaaaaatgaactaccctctgccataaagtttctg
atgggagaggaagagacattttcagcctggtatgtggatggccgtgttctggtggtgata
gttacctttggcataattctccctctgtgtctcttgaagaatttagggtatcttggctat
accagtggattttccttgagctgtatggtttttttcctaatagtggttatctacaagaaa
tttcagattcgctgcgatgttccggagctaaatttaacaaactctgctgctaattcaaca
aatgctgacatgtgtatgccaaaatatgttaccttcaattcaaagaccgtgtatgcacta
ccaactattgcatttgcatttgtctgtcacccatcagtcctgccgatttacagcgagctt
aaagatcgatcacagaaaaagatgcagatggtttcaaatatctcctttttcgccatgttt
gttatgtatttcttgactgccatttttggctacttgacattctatgaacgcgtggaatca
aacctccttcacaagtaccatagtaaaaacgacattctcatcctgaccgtgcggctggct
gtcattgttgctgtcatcctcacagtgccagtgttatttttcacagttcgctcatcttta
tttgaactggctaaaaaaacgaagtttaatttatgtcgtcatatctctgttaccgtcata
ctcttggttattatcaacttgttggtgatcttcataccctccatgaaggatatttttgga
gtcgtgggagttacatctgctaatatgcttattttcattcttccttcatctctttattta
aaaatcacaaaccaggatggagataaagggactcaaagaatttgggtatgtctcatgcca
gccactctcatttttctgattagtttttccatttccatttgccaaataaatagtcgatct
ccaccatgtgatactacttttaatggccttgaggggaggcaacagtcagtcctgtag

DBGET integrated database retrieval system