KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521499
Entry
107521499         CDS       T06036                                 

Gene name
LMNA
Definition
(RefSeq) lamin isoform X1
  KO
K12641  lamin A/C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04210  Apoptosis
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107521499 (LMNA)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107521499 (LMNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107521499 (LMNA)
   05414 Dilated cardiomyopathy
    107521499 (LMNA)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     107521499 (LMNA)
SSDB
Motif
Pfam: Filament LTD TPR_MLP1_2 Crescentin HAUS-augmin3 ATG16 Fez1 TolA_bind_tri Tht1 Spc7 CENP-F_leu_zip zf-NADH-PPase DUF4407 Apolipoprotein
Other DBs
NCBI-GeneID: 107521499
NCBI-ProteinID: XP_016021733
LinkDB
Position
Unknown
AA seq 675 aa
METPSQRRATRSGAQTSSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYESELSDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLMAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSATKKRK
LEAAESRSSFSQHARTSGRVAVEEVDEDGKFVRLRNKSNEDQTMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDMIHHHHGPQVAGRPTLGSHCSGSGDPAEYNLRSRTVLCGT
CGQPAEKASAGGGAGAQVGGSVSSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLG
NSRARTQSPQNCSIM
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggagactccgtcccagcggcgcgccacccgcagcggggcgcagaccagctccaccccg
ctgtcgccgacccgcatcacccggctgcaggagaaggaggacctgcaggagctcaacgac
cgcttggcggtctacatcgaccgtgtgcgatctctggagacggagaatgcgggtctgcgc
cttcgcatcaccgagtcggaggaggtggtcagccgcgaggtgtccggcatcaaggccgcc
tacgagtccgagctcagcgatgcccgcaagaccctcgactcggtggccaaggagcgcgcc
cgcctgcagctggagctgagcaaagtgcgcgaggagtttaaggagctcaaagcgcgcaat
accaagaaggagggagacctgatggccgcccaggcccggctcaaggacctggaggctctg
ctcaactccaaggaggccgcgctgagcacagccctcagcgagaagcgcacgctggagggc
gagctgcatgacctgcggggccaagtggccaagctcgaggcagccctgggggaggccaag
aagcagcttcaggacgagatgctgcggcgggtcgatgccgagaacaggctgcagactctg
aaggaggagctggacttccagaagaacatctacagcgaggagctgcgtgagaccaagcgc
cgccacgagacacggctggtggagatcgacaacggcaagcagcgggagttcgagagccgg
ctggccgacgccctgcaggagctgcgggcccagcacgaggaccaggtggagcagtacaag
aaggagctggagaagacctactccgccaagctggacaacgccaggcagtcggccgagagg
aacagcaacctggtgggcgcggcccacgaggagctgcagcagtcccgcatccgcatagac
agcctgtccgcgcagctcagccagctgcagaagcagctggcagccaaggaggcgaagctg
cgggacctggaggactccctggcccgcgagcgcgacaccagccggcgcctgctggcggag
aaggagcgggagatggcggagatgcgggcgcgcatgcagcagcagctggacgagtaccag
gagctgctggacatcaagctggcgctggacatggagatccacgcctaccgcaagctgctg
gagggcgaggaggagaggctccgcctgtcccccagccccacctcgcagcgcagccgcggc
cgagcctcctcccactcgtcccagacgcagggtgggggcagcgccaccaagaagcggaag
ctggaggccgccgagagccgcagcagcttctcgcagcacgcgcgcaccagcgggcgcgtg
gccgtggaggaggtggacgaggacggcaagttcgtgcggctgcgcaacaagtccaacgag
gaccagaccatgggcaactggcagatcaagcgccagaacggagatgaccccctgctgacc
taccgcttcccgccgaagttcaccctgaaggccgggcaggtggtgacgatctgggctgca
ggagctggggccacccacagccccccgaccgacctggtgtggaaggctcagaacacctgg
ggctgtggcaacagcctccgcacggccctcatcaactccaccggggaggaggtggccatg
cgcaagctggtgcgctcggtgactgtggtcgaggatgacgaggacgaggatggagatgac
atgatccatcaccaccacggaccccaggtggctgggcgccctactctgggctcccactgc
agcggctcgggcgaccccgctgagtacaacctgcgctcccgcaccgtgctgtgcgggacc
tgcgggcagcctgccgaaaaggcgtccgccggcggcggcgcgggagcccaggtgggcgga
tccgtctcctctggctcctccgcgtccagcgtcacagtcactcgcagctaccgcagtgtg
gggggcagtgggggtggcagcttcggggacaacctggtcacccgctcctacctcctgggc
aactccagagcccgaacccagagcccccagaactgcagcatcatgtaa

DBGET integrated database retrieval system