KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521551
Entry
107521551         CDS       T06036                                 

Gene name
NRG2
Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform isoform X1
  KO
K05456  neuregulin 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04012  ErbB signaling pathway
ray05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107521551 (NRG2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107521551 (NRG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107521551 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107521551 (NRG2)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107521551 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set Ig_6 EGF_2 EGF MIEAP EptA_B_N DUF3169
Other DBs
NCBI-GeneID: 107521551
NCBI-ProteinID: XP_016021825
LinkDB
Position
Unknown
AA seq 932 aa
MRQVCCSALPPPPVEKARCSSYSDSSSSSSSGSSSSSSSSSERSSSSSSSDSKSSSSSSR
SSSSSYSSISRPAAPPEPRPPQQPQPRSPAAPRAAARSRAAAAGGMRRDPAPGFSMLLFG
VSLACYSPSLKSVQDQAYKAPVVVEGKVQGLAPAGGSSANSTREPPASGRVALVKVLDKW
PLRSGGLQREQVISVGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGK
ILCTDCATKPKLKKMKSQTGQVGEKQSLKCEALAGNPQPSYRWFKDGKELNRSRDIRIKY
GNGRKNSRLQFNKVKMEDAGEYVCEAENILGKDSVKGRLHVNSVSTTLSSWSGHARKCNE
SAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWDTPGTGV
NSSQWSTSPAGCWCLKSPDQRFSLSLSPALVLPHLSLYLSLHPFPFLALLSSALPEHLGF
ELKEAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKKMHNHLRQNLCPAHQNRS
LANGPSHPRLDPEEIQMADYISKNVAATDHVIQRETETTFSGSHSCSPSHHCSTATPTSS
RRHESHTWSLERSESLTSDSQSGIMLSSVGTSKCNSPACVEARARRAAAYSLEEHRKATM
PPYHDSVDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPP
AAPISYRLAEQEPLLGHPAPPGPGPSTEMQHNYDSYYYPAAGPGPRRSACALGGSLGSLP
ASPFRIPEDDEYETTQECVPPPPPPPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARD
SLSLSSGSGGGSASDDDDDDDDADDADGALAAESTPFLSLRSGHEALRSDSPPLCGAADS
RTYYSLDSHSTRASSRHSRAPPPRAKQDSAPL
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccagtggagaaggctcggtgcagc
agctacagcgacagcagcagcagcagcagcagcggcagcagcagcagcagcagcagcagc
agcgagagaagcagcagcagcagcagcagcgacagcaagagcagcagcagcagcagcagg
agcagcagcagcagctacagcagcatctctcgtcccgctgcgcccccagagccgcggccg
ccgcaacagccgcagccccgcagccccgcagccccgagagccgccgcccgctctcgagcc
gcagctgccggcggcatgaggcgcgacccggcccccggcttctccatgctgctcttcggt
gtgtcgcttgcctgctactcgcctagcctcaagtcggtgcaggaccaggcttacaaggca
cccgtggtggtggagggcaaggtacagggactggccccagccggcggctccagcgccaac
agcacccgcgagccgcccgcctccggtcgggtggcgctggtgaaggtgctggacaagtgg
ccgctccggagcggggggctgcagcgcgagcaggtgatcagcgtgggctcctgtgcgccg
ctcgaaaggaaccagcgctacatctttttcctggagcccacggagcagcccttagtcttt
aagacggcctttgcccccctcgacaccaacggcaaaaacctcaagaaagaggtgggcaag
atcctgtgcactgactgcgccaccaagcccaagctgaagaagatgaagagtcagacagga
caagttggagagaagcaatcgctgaagtgcgaggccctggccggtaacccccagccatcc
taccgctggtttaaggatggcaaggagctcaaccgcagccgagacattcgcatcaagtat
ggcaatggaagaaagaactcacgactgcagttcaacaaggtgaagatggaggatgctggg
gagtatgtctgcgaggccgagaacatcctggggaaggactcggtcaaaggccggctccac
gtcaacagcgtgagcaccactctgtcatcctggtcaggacatgcccggaagtgcaacgag
agtgccaagtcctactgtgtcaatggaggcgtctgctactacatcgagggcatcaaccag
ctctcctgcaaatgtccaaacggattcttcggacagagatgtttggagaaactgcctttg
cgattgtacatgccagatcctaagcaaagtgtcctgtgggatacaccggggacaggtgtc
aacagttcgcaatggtcaacttctccagctggctgctggtgtctgaagagtcctgaccaa
cgtttctctctctctctctctcccgcccttgtcctcccccatctctctctgtatctctcc
ctccatccctttccctttctggccctcctctcttctgcactgccagagcatcttggattt
gaactaaaggaagctgaagagctgtaccagaagagggtcctgactatcaccggcatctgt
gtggctctgctggtcgtgggcatcgtctgcgtggttgcctactgcaagaccaaaaaacaa
cggaagaagatgcacaaccacctgcggcagaacttgtgcccagcccaccagaaccggagc
ctggccaatggacccagccacccccggctggaccctgaagagatccagatggcagattat
atctccaagaacgtggcagccacagaccatgtcatccaaagagagaccgagaccaccttc
tctggaagccactcctgctctccatctcaccactgctccacagccacgcccacctccagc
cgtagacatgagagccacacatggagcctggaacgttctgagagcctgacctctgactcc
cagtccggaatcatgctgtcatcggtgggcaccagcaagtgcaacagcccggcttgtgtg
gaggcccgggcacgtcgggcagcagcctatagcctggaggagcaccgcaaggccaccatg
ccaccttaccatgactccgtagactccctgcgtgactccccacacagtgagaggtacgtg
tcggccctgaccacgcccgcgcgcctctctcctgtagacttccactactcgctggccacg
caggtgccgactttcgagatcacgtcccccaactcggcacacgccgtgtcgctgccgccg
gccgcgcccatcagctaccgcctggcggagcaggagccgctcctggggcacccggcgccc
cctgggccggggcccagcactgagatgcagcacaactacgacagctactactatcccgcg
gcagggcccgggccgcggcgcagcgcctgcgcgctgggcggcagcctgggcagcctgccc
gcgagccccttccgcatccccgaggacgacgagtacgagaccacgcaggaatgcgtcccc
ccgccgccgccaccgccgcgagcccgcggtgcgtcccgcaggacatcggcgggacctcgg
cgctggcgccgctcacgccttaacgggctggcggcgcagcgcgcacgcgccgcccgagac
tcgctgtccctgagcagcggctccggcggcggctcggcctccgacgacgacgacgacgac
gacgacgccgacgacgccgacggggcgctggcagccgagagcacgcccttcctcagcctg
cgcagcgggcacgaggcgctgcgctcggactcgccaccgctctgcggggcagccgacagc
aggacttactactccctggacagccacagcacgcgcgccagcagcagacacagccgcgcg
ccgcccccgcgggccaagcaggactcagcgcccctctag

DBGET integrated database retrieval system