KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521572
Entry
107521572         CDS       T06036                                 

Gene name
HBEGF
Definition
(RefSeq) LOW QUALITY PROTEIN: proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05171  Coronavirus disease - COVID-19
ray05205  Proteoglycans in cancer
ray05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107521572 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107521572 (HBEGF)
   04915 Estrogen signaling pathway
    107521572 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    107521572 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107521572 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    107521572 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107521572 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107521572 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107521572 (HBEGF)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107521572 (HBEGF)
SSDB
Motif
Pfam: EGF Syndecan CD34_antigen
Other DBs
NCBI-GeneID: 107521572
NCBI-ProteinID: XP_016021869
LinkDB
Position
Unknown
AA seq 214 aa
MKLLPSVLLKLFMAAVLSALVTGESLERLRRGLAAGTSNLGSPTESTDQLMLPPGGRGRE
VLDLEEANLDLFRVLFLLXLLFSAKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKD
FCIHGECQYVKAIRGPSCICHPGYHGERCHGLSLPVENRLSTYDHTTILAVVAVVLSSVC
LIVIVGLLMFRYHRRGGYDVENEEKVKLGMTTSH
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtgttgctgaagctctttatggctgcagtgctctcggcgttg
gtgaccggagagagcctggagcggcttcggagagggctggcggctggaaccagcaacctg
ggctctcccactgaatctacggaccagctgatgctcccgccaggcggccggggccgggaa
gtcctggacttggaagaggccaacttggaccttttcagagtgctttttctcctatagctg
cttttctctgctaaaccacaagctctggccacacccagcaaggaggaacgtgggaaaaga
aagaagaaaggcaaggggttagggaagaagagagacccgtgtcttcggaagtacaaggac
ttctgcattcacggagaatgccaatatgtgaaggcaatccggggtccatcttgcatctgc
cacccaggttaccacggagagaggtgccatgggctgagcctcccggtagaaaatcgctta
tctacttatgaccacacaaccatcctggctgtggtggccgtggtgctgtcgtctgtctgt
ctgatcgtcatcgtggggcttcttatgtttaggtaccataggagaggaggttatgatgtg
gaaaatgaagagaaagtgaagttgggcatgactacttcccactga

DBGET integrated database retrieval system