KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521616
Entry
107521616         CDS       T06036                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00590  Arachidonic acid metabolism
ray01100  Metabolic pathways
ray04064  NF-kappa B signaling pathway
ray04370  VEGF signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04668  TNF signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04726  Serotonergic synapse
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05140  Leishmaniasis
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05204  Chemical carcinogenesis
ray05206  MicroRNAs in cancer
ray05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107521616 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107521616 (PTGS2)
   04064 NF-kappa B signaling pathway
    107521616 (PTGS2)
   04668 TNF signaling pathway
    107521616 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107521616 (PTGS2)
   04657 IL-17 signaling pathway
    107521616 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107521616 (PTGS2)
   04913 Ovarian steroidogenesis
    107521616 (PTGS2)
   04921 Oxytocin signaling pathway
    107521616 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    107521616 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    107521616 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521616 (PTGS2)
   05206 MicroRNAs in cancer
    107521616 (PTGS2)
   05204 Chemical carcinogenesis
    107521616 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107521616 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107521616 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    107521616 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107521616 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107521616 (PTGS2)
   05165 Human papillomavirus infection
    107521616 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107521616 (PTGS2)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107521616 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Other DBs
NCBI-GeneID: 107521616
NCBI-ProteinID: XP_016021942
LinkDB
Position
Unknown
AA seq 604 aa
MLARALVLCAALALSSAVNPCCSNPCQNRGICMSVGFDQYTCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSDLIDSPPTYNAHY
GYKSWEAFSNLSYYTRVLPPVADDCPTAMGVKGKKELPASEVIVEKFLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QIIDGEMYPPTVKDSQVEMIYPPHIPEHLRLAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIEDQEYNYQQFIYNNSVLLEHGLTQFVESCSRQTAGRV
AGGRNFPAAIQYVAKASIDQSRQMKYQGLNEYRKRFRMKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNPICSPHYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPSTSFSVQDPQPTKAVTISASPSHSGLDDINPTVLLKGR
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgctggcccgcgccctggtgctctgcgccgccctggcgctcagcagtgcagtaaatcct
tgctgttccaacccatgtcaaaaccgaggcatatgtatgagtgttggattcgaccagtac
acgtgtgactgtacccgaactgggttctatggtgaaaactgttcaacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggtgtctggaacatcgttaataatattcccttcttgagaaatgcaattatgaaa
tatgtgttgacatccagatcagatctgattgacagcccaccaacttataatgcacactat
ggctacaaaagctgggaagccttttctaatctctcctattataccagagttcttccccct
gtggctgacgactgcccaactgccatgggtgtgaaagggaagaaagagcttcctgcttca
gaagtgattgtggaaaaatttctcctaagaagaaagtttatccctgatccccagggcaca
aatttgatgtttgcattctttgcccagcatttcacccatcaatttttcaagacagatcat
aagcgaggaccagcttttaccaaaggactgggtcatggggtggatttaaatcatatttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaactgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatagtcaggtggagatgatc
tatccccctcacatccctgaacacctgcggcttgctgtggggcaggaggtgtttggcctg
gtgcctggtctgatgatgtacgccacgatttggctgcgagagcataacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgacgagcgtctgttccagacaagcaggctg
atactgataggagaaactattaagattgtgattgaagactacgtacaacacttgagtgga
tatcacttcaaactgaagtttgacccagagctccttttcaatcaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttttgcctgacacc
tttcagatcgaagaccaagagtacaactatcaacagtttatctacaacaactccgtatta
ctggaacatgggcttacccagtttgtcgaatcatgcagtaggcaaactgctggcagggtt
gctggtggtaggaattttccagctgcaatacaatatgtagcaaaggcttcaatcgaccaa
agcagacagatgaaataccagggtctcaatgagtaccgcaaacgctttcggatgaagccc
tatgaatcatttgaagaactcacaggagagaaggaaatggctgcggagttagaagcactt
tatggtgacattgatgccatggagctgtatcctgcccttctggttgaaaagcctcgtcca
gatgccatctttggtgagactatggtagaagttggagcacctttctccttgaaaggactt
atgggtaatcctatatgttctcctcactactggaagcctagcacttttggtggagaagta
ggctttaaaatcatcaacaccgcctcaattcagtctctcatctgcaataatgtgaaaggt
tgtccttctacgtcgttcagtgttcaagatccacagcccaccaaagcagtcaccattagt
gcaagcccttcccactctggactagatgatatcaaccccacagtactactaaaaggacgt
tcaactgaactgtag

DBGET integrated database retrieval system