KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521917
Entry
107521917         CDS       T06036                                 

Gene name
SGCD
Definition
(RefSeq) delta-sarcoglycan
  KO
K12563  delta-sarcoglycan
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107521917 (SGCD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107521917 (SGCD)
   05414 Dilated cardiomyopathy
    107521917 (SGCD)
   05416 Viral myocarditis
    107521917 (SGCD)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 107521917
NCBI-ProteinID: XP_016022575
LinkDB
Position
Unknown
AA seq 289 aa
MPQEQYTHHRSTMPSSEGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMN
FTIDGMGNLRITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTKV
LTQLITGPKAVEAYGQKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETP
NVRADPFKELRLESPTRSLVMEAPKGVEINAEAGNMEATCRTELRLESKDGEIKLDAAKI
KLPRLPHGSYTPTGTRQKVFEICVCANGRLFLSQAGTGSTCQINTSVCL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcctcaggaacagtacacacatcaccggagcaccatgcccagctccgaggggccacag
gtatacaaagtggggatttatggctggcggaaaagatgcctgtatttctttgtcctgctc
ctgatgattttaatactggtgaacttggccatgaccatctggattctcaaagtcatgaac
ttcacaattgatggaatgggaaacttgagaatcacagaaaagggtctcaagctagaagga
gactcagaattcttacaacctctctacgccaaagaaatccagtccagaccgggtaatgcc
ctgtacttcaaatcagccagaaatgtgacagtgaacattctcaatgaccagactaaagtg
ctaactcagctgataacaggtccaaaagccgtagaagcttatggccaaaagtttgaagta
aagacagtgtctggaaaattgctcttttctgcagataacaatgaagtggtagtaggagct
gagagattacgagttttaggagccgagggcacagtgttccctaaatctatagagacacct
aatgtcagggcagaccccttcaaggaactaaggttggagtccccaacccggtctctggtg
atggaggccccgaaaggagtagaaataaacgcagaagccggcaacatggaagccacctgc
agaacagagctgagactggagtccaaagacggagagattaagttagatgctgcgaaaatc
aaactacctagactgcctcacggatcctacacgcccactggaacgaggcagaaggtcttc
gagatctgcgtctgcgccaacgggaggctatttctgtcccaggcaggaaccggttccact
tgtcagataaacacgagtgtctgcctttga

DBGET integrated database retrieval system