KEGG   Rhodopirellula baltica: RB10991Help
Entry
RB10991           CDS       T00134                                 

Definition
(RefSeq) MarR family transcriptional regulator
Organism
rba  Rhodopirellula baltica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2
Motif
Other DBs
NCBI-GeneID: 1793478
NCBI-ProteinID: NP_869726
UniProt: Q7UJX7
LinkDB All DBs
Position
5956313..5956789
Genome map
AA seq 158 aa AA seqDB search
MMTPSSLREELKKKGPFESLEQEAMLGILRTSDLLENRLARLLRTFSLTPSQYNAMRIMR
GEKVPMPCLEVADRMIQVSPAITRVVDQLLNRGLIHKQQSNQDRRVFLVGLTDEGLTLLD
KLDEPIQSLHRELLGHVPAEDLHSLNRILQIARERIPG
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacgccgtcctctttgcgcgaagagctcaagaaaaagggaccgttcgaatcgctt
gagcaggaggccatgctggggattctaagaaccagcgatctgcttgagaatcgtttggct
cgtctgctgcgaaccttcagtttgactccttcgcaatataacgcgatgcggatcatgcgg
ggcgagaaggttccgatgccgtgtctggaagttgctgatcggatgatccaggtttcacct
gcgatcactcgcgtggtcgaccaattgctcaatcgaggattgattcacaagcagcaatcc
aatcaagatcgtcgggtttttttggtgggactgactgacgaagggctcactttgctggac
aaattggatgagcccatccaatcgctgcatcgcgagttgctggggcatgtcccggccgag
gatctgcactcgctcaatcggattctgcaaattgcccgcgagcggatccccggctga

DBGET integrated database retrieval system