KEGG   Rhodopirellula baltica: RB13271Help
Entry
RB13271           CDS       T00134                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rba  Rhodopirellula baltica
Pathway
rba00550  Peptidoglycan biosynthesis
rba01100  Metabolic pathways
rba01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RB13271 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RB13271 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RB13271 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rba01011]
    RB13271 (ddlA)
Enzymes [BR:rba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RB13271 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:rba01011]
 Precursor biosynthesis
  Amino acid ligase
   RB13271 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATPgrasp_ST ATP-grasp_3 ATP-grasp ATP-grasp_4 GARS_A RimK CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 1789921
NCBI-ProteinID: NP_870957
UniProt: Q7UHD8
LinkDB All DBs
Position
complement(7117533..7118558)
Genome map
AA seq 341 aa AA seqDB search
MSKLRVLVLVREGNVPPDTLEGFTDKESDPWKAEYDVCETLRGLGHEVLPLGIFDDLAPI
RAALQNFQPNITYMLLEEFYGVVTYDFAVISYLELMQQPYSGCNPRGLMLSKDKALSKKL
LMYHRIATPRFAVFPNGRAVRRPKKLEFPLFVKSTIEDASFGIAQASIVHNDEALAERVT
FLHEKTGGDVIVEQYIEGRELYVGVMGNTRLVTFPAWEMDFGKMPDESARIATSRVKWDR
KYQEKHDITCHAAEGLTEVQQKHIAKLCKRVYRALHMSGYARMDLRMTATGEVYVIEANA
NPNIEYGEDFAESAEAAGIPYESLIQRILNLGLSYRAAWMG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattgcgtgtgctggttttggtccgagaaggcaacgttccaccggataccctg
gaaggattcaccgacaaagaatctgacccgtggaaggcggaatatgatgtctgtgaaacc
cttcgcggactcgggcatgaggttctaccgctggggatctttgatgacctggctcccatt
cgtgcggccctgcagaactttcaacccaacatcacctacatgttgctggaagagttctac
ggtgtggtcacctacgatttcgcggtgatcagctatctcgaattgatgcagcaaccctac
agcggatgcaacccgcggggattgatgctcagcaaagacaaggcgttgtcgaaaaaactg
ctgatgtatcaccgaatcgccacgccgcgtttcgcagtttttccgaatggccgcgcggtg
cgtcgtccgaaaaaactcgaattcccgttgtttgtcaaatcaaccatcgaggacgcttcg
ttcggtatcgctcaagcctcgatcgttcacaacgacgaagcactcgccgaacgagtcacc
ttcttgcacgagaagacgggcggcgacgtgattgtcgagcaatacatcgagggtcgcgaa
ttgtatgtcggcgtgatgggcaacactcgattggtgacctttcccgcttgggaaatggac
tttggcaaaatgcccgatgagtcggctcgaatcgcgaccagccgagtcaaatgggaccgc
aaataccaagaaaaacacgacatcacctgtcatgccgccgaaggtttgaccgaggtccag
caaaagcacatcgccaagctttgcaaacgggtgtaccgagcgcttcacatgagtggctac
gctcgcatggatttgcggatgactgccacgggcgaagtttacgtgatcgaagccaatgcg
aaccccaacatcgaatacggggaagacttcgctgaatctgccgaagccgccgggattccc
tacgaatcgttgattcaacgcattctcaaccttggattgagctaccgagccgcttggatg
gggtga

DBGET integrated database retrieval system