KEGG   Rhodopirellula baltica: RB3353Help
Entry
RB3353            CDS       T00134                                 

Definition
(RefSeq) sialidase [precursor]
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
rba  Rhodopirellula baltica
Pathway
rba00511  Other glycan degradation
rba00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    RB3353
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RB3353
Enzymes [BR:rba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     RB3353
Bacterial toxins [BR:rba02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   RB3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10 F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 1792895
NCBI-ProteinID: NP_865457
UniProt: Q7UUD9
LinkDB All DBs
Position
complement(1724290..1725519)
Genome map
AA seq 409 aa AA seqDB search
MSRQQSALLPRRVDRQVFSAILSALAAICLFITMLPAKAEANDEARGQREIVDVFVPEQD
GYPAIRIPSLITTNHGTLLAFAEGRQGGDHSENDLIMKRSTDNGSTWSDVVLLNDQGKLS
LNNPQAVVLQSGRILLMYQRSKLGEHKASDGYGPNSYFTFVQTSDDDGQTWAAPRDVSKQ
VKREKKVTSVAAGPGIGIVLQNGPHKGRIIMPFNQGPYNNWRVYAAYSDDDGQTWNMGDV
APGDGKGHANEVQMVELSDGRVMLNARTQGKGSTKHRKVAVSDNGGQTWSQLQMDQTLIE
PTCQASILRYSWPSKGKSRIIFSNPASQTKRENGVLRISYDEGQSWPSQTDVYPGGFAYS
CLTRMQDGRIGVLFERDNYKTISFVAISLSDLDSSESQNESSETDQENN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgccagcaatccgcgctgcttccacgcagagtcgatcgacaggtcttctctgcc
atcctgtccgccttggccgcaatctgccttttcatcacgatgttgccggctaaagcggaa
gccaacgacgaagccaggggccagcgagagattgtcgacgtctttgttcccgaacaagac
ggatatcctgcgattcgcattccttcgctgatcaccaccaaccacggaaccttgctggct
tttgccgaaggtcgccagggcggggatcattccgaaaacgatttgatcatgaagcgttca
accgacaacggttccacctggagcgacgttgttcttttgaacgatcagggcaaactctcc
ttgaacaacccgcaagccgtcgtgctgcaatccggccgaatcttgctgatgtaccaacgc
agcaagctcggcgaacacaaagcgtccgacggctacggaccgaattcgtatttcactttt
gttcaaacaagcgacgatgatgggcagacttgggccgcaccccgcgacgtttccaagcaa
gtgaaacgtgaaaaaaaggtgaccagcgttgccgccggccccgggatcggaatcgtcctg
caaaacggtccgcacaaggggcggatcatcatgccgttcaaccaaggcccctacaataac
tggcgagtatacgctgcctacagcgacgatgatggccagacctggaacatgggcgatgtg
gctccgggcgacggcaaaggccacgccaacgaagtccagatggtcgagctatccgacggt
cgcgtcatgcttaacgcgcggactcagggcaaaggatcgaccaaacatcgcaaggtcgct
gtcagtgacaatggcggtcaaacctggtcgcaactgcagatggatcaaacattgatcgaa
ccgacgtgccaagcatcgattcttagatactcctggccttccaaaggcaaaagccgaatc
atcttctcgaacccggcgtctcaaacgaaacgggaaaacggagttcttcgcattagctat
gacgaaggtcaatcatggcccagtcaaacggacgtctacccaggcggctttgcctactca
tgtttgacgcgaatgcaggacggtcgcatcggagtcctctttgaacgcgacaactacaaa
acaatcagcttcgttgcgatctcattgagtgatctggattcatccgaatcgcaaaacgaa
tcgtctgaaaccgaccaggagaacaattga

DBGET integrated database retrieval system