KEGG   Rhodothermaceae bacterium RA: AWN76_001470
Entry
AWN76_001470      CDS       T04780                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
rbar  Rhodothermaceae bacterium RA
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rbar02044]
    AWN76_001470
Secretion system [BR:rbar02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AWN76_001470
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ARA91963
UniProt: A0A1V0DA98
LinkDB
Position
334905..335957
AA seq 350 aa
MEPSARRQTSSVGGPDDGVPFPPQSLYARLLREGYRFNFYQAVRLLERLFPEAPKPGTSG
AGPAERIRFRPDHAMVFPAADIRRVTWHDGPVPHVELVATFLGLYGIDAPMPPAFFEPIT
LEQSEAEPLKAFLDLFNQRFYAYFYRAWKKYRPNLHDSDTGQQADLRRFLAVAGLGTPGA
AAPPTSAFVLSAFAARLVHRPRNAEGLRSLVQSLLGEVPVHIQEFVPTWVPLPHRGRLGR
RAGMRLGEDALLGERVYDVAGTFRIRLGPLGLETYLSLLPGGTQARRLRDLVCMYTAHTL
AYDVELVVRAAEMPRLRLGDRRARLGLTTCLGATRAGLMHRVVSYPTGAA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggaaccctcagcgcggcgacagacctcttctgtaggcggcccggatgacggcgtgccg
tttcctccgcagagcctctatgcgcggttgctgcgggagggataccgtttcaatttctac
caggccgtccggctgctggaacgtctcttcccggaggcgccgaaaccggggacgtccgga
gccgggccggccgagcgcatccgcttccggccggaccatgccatggtgtttcccgctgcc
gatatccggcgggtgacgtggcacgacggcccggtgccgcacgtggaactggtggcgacg
ttcctgggcctctacggcatcgacgcccccatgccccccgccttcttcgaaccgatcacg
ctggagcagtccgaagcggagccgctgaaggccttcctggaccttttcaatcagcgcttt
tacgcctacttctaccgggcctggaagaaataccgccccaacctgcacgattcggacacc
gggcagcaggcggatctgcggcgcttcctggccgtggccgggctgggcacgccgggagcc
gccgccccgcccacgtcggccttcgtcctcagcgccttcgcagcgcgcctcgttcatcga
ccccggaatgcggaggggctccgaagtctggtgcagtcgctgctgggggaggtgccggtg
cacattcaggagttcgtgcccacctgggtgccgctcccgcatcgcgggcgtctggggcgc
cgggcggggatgcgtctgggcgaggatgccctcctcggtgaacgtgtctacgacgtagcc
ggcacgtttcgcatccggctgggaccgctcggcctggagacgtacctgtcgctgttgccg
ggtgggacacaggcccgccggctgcgggatctggtctgcatgtacaccgcccacacgctg
gcctacgacgtcgagctcgtcgtccgagcggccgagatgccacggctccgcctgggcgac
cggcgggcccggctgggcctgacgacctgcctgggcgccacgcgtgccggcctgatgcac
cgcgtcgtgtcgtacccgaccggggcggcctga

DBGET integrated database retrieval system