KEGG   Rhodothermaceae bacterium RA: AWN76_003290Help
Entry
AWN76_003290      CDS       T04780                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:rbar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWN76_003290
Enzymes [BR:rbar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AWN76_003290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ARA92294
UniProt: A0A1V0DBA5
LinkDB All DBs
Position
complement(791436..792920)
Genome map
AA seq 494 aa AA seqDB search
MPPRFQNYIGGTWQDAAGGAVFEDVNPARMSDVIGYFPKSGAADVDRAVQAAREALPAWS
RRPAPSRGEILRRIGDLLTERKDAIAFEMTREMGKPHFETRGDVQEAIDTAYYAASETRR
LFGHTVPSELPNKFNMSIRRPIGVCGIITAWNFPVAVPTWKIFPALAAGNTVVFKPSEDA
PHSGMLLVQVLIDAGVPAGVVNLVQGAGEAGAALVEHPGVDAISFTGSTETGARIGETCG
RLHKRFSLEMGGKNPMIVMEDADLHLALEGVLWGAYGTTGQRCTATSRLIIHEDVHDVFV
EMIRERAEALRLGYGNDEGVDMGPLINQDALDKVTRYVQIGREEGATLLFGGTRATGNGL
DEGFFFKPTLFTDVKPGMRIEQEEIFGPVLSVIKVRSYEEAVAVANGVRYGLSSSIYTRD
VARAFQAMHDIEAGITYVNGPTIGAEAHMPFGGVKQTGNGHREGGWEVFDFYTETKTVYV
DYSGKLQKAQIDNT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcgctttcagaactacatcggtggaacctggcaggatgcggctggcggcgcc
gtattcgaagacgtcaaccccgcccgtatgagcgacgtcatcggctatttcccgaagtcc
ggcgcggccgacgtcgaccgggccgtacaggcggcccgtgaggcgctgccggcgtggagc
cgccggcccgccccctcccgtggcgagatcctgcgccgcatcggcgacctgctgaccgaa
cgcaaggatgccatcgccttcgagatgacccgggagatgggcaaaccgcacttcgagacg
cggggcgacgtgcaggaggccatcgacacggcgtactacgcggcgtcggaaacccggcgg
ctgttcgggcacacggtcccgagcgagttgccgaacaagttcaacatgagcatccgccgg
ccgatcggggtctgcgggatcatcacggcctggaacttccccgtcgccgtgcccacgtgg
aagatcttcccggcgctggcggcgggcaacaccgtcgtcttcaagcccagcgaggacgcc
ccccacagcggcatgctgctcgtgcaggtgctgatcgacgcgggcgtgccggccggggtc
gtgaacctggtgcagggcgccggggaggccggggccgccctcgtggagcacccgggcgtc
gatgccatctcgttcaccggatcgaccgagacgggtgcccggatcggtgagacgtgcgga
cggctgcacaagcgcttctcgctggagatgggcggcaagaaccccatgatcgtgatggag
gatgccgacctccacctggcgctggagggcgtcctctggggcgcctacggcacgaccggc
cagcgctgcacggccacgagccgcctcatcatccacgaggacgtgcacgatgtcttcgtg
gagatgatccgcgagcgggccgaggccctccggctggggtacggcaacgacgagggcgtc
gatatgggcccgctcatcaaccaggacgccctcgacaaagtcacccgctacgtgcagatc
ggccgggaggagggcgccaccctgctcttcggcggcacccgcgccaccggcaacggcctc
gacgagggcttcttcttcaagccgacgctcttcaccgacgtcaagcccggcatgcgcatc
gagcaggaggagatcttcggtcccgtgctctcggtcatcaaggtgcgcagctacgaagag
gccgtcgccgtggccaacggcgttcgctacggcctctcctcatccatttacacgcgcgac
gtcgcccgcgccttccaggcgatgcatgacatcgaagccggcatcacctacgtcaacggc
ccgaccatcggtgccgaggcacacatgcccttcggcggggtcaagcagacgggcaacggc
caccgcgaaggcggctgggaggtcttcgacttctacacggagacgaagaccgtctacgtc
gactactcgggcaagcttcagaaggcccagatcgacaacacctga

DBGET integrated database retrieval system