KEGG   Rhodothermaceae bacterium RA: AWN76_004480Help
Entry
AWN76_004480      CDS       T04780                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00620  Pyruvate metabolism
rbar00680  Methane metabolism
rbar01100  Metabolic pathways
rbar01120  Microbial metabolism in diverse environments
rbar01200  Carbon metabolism
Module
rbar_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWN76_004480
  09102 Energy metabolism
   00680 Methane metabolism
    AWN76_004480
Enzymes [BR:rbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AWN76_004480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase HD_4 MAP7
Motif
Other DBs
NCBI-ProteinID: ARA92497
UniProt: A0A1V0DCF6
LinkDB All DBs
Position
1082200..1085013
Genome map
AA seq 937 aa AA seqDB search
MSTPQTLQEETRQAGISAPLSEHIALLGDMLGEALREQAGPDVFDLVIELRRLCRDAEPD
RIASAFAEVAHRIRPLDLETITWLLRGYTALFHLINKAEQQEIIRINRERALHSNPDAPR
PESIAEAIHTLKQQGASLDDVLALLRRLDIQPTLTAHPTEARRRSILFKQQRIAALLHTL
RYGKPTPEEAERILAETRNQIRLLLATDEVRPERLHVEDEVEHGLYFVRHTIWHTIPRIY
RDVQQALAQYYEAHVDFPVFLRYRSWIGSDRDGNPNVTPAVTRHTLLVQRRTALELYLTA
LRDLRRELSVSDQQVPVPDALRASIEADAAAISLDPIRLRQYQHEPFRLKLSYLIARLER
LRARLDAPAASSPAEAYTSTDFIADLRLIRQCLDACGLGEVAHSGPLSDLLVQAQTFGFH
MMALDVRQHSRVHEEVVTTLLRLAGVTDDYAALPEAERQRVLSAELANPRPLVPRGTDLP
DPARSVMDTLTVIREAVAHEPLSIGSYIISMTHEVSDLLEVMLLAKEAGIWRMDGDTVHC
PIDFVPLFETIEDLGEADAFMERLFTHPIYRRHLAARGQFQEMMLGYSDSNKDGGYWMAN
WALHQAQDRLGRVCRRHGIDFRLFHGRGGTVGRGGGRANQAILSMPSACQSGRIRFTEQG
EVISFRYALSDIARRHVEQIVNAMIRATSRPYDGDEAVPVAEGAPEHALMDRIADRSMAA
YRRLIEDPRFWPWYTKATPIEHISRLPIASRPVSRKTGGEVDFESLRAIPWVFAWTQTRY
NVPGWFGIGEALQALIDGEPGTLDQLRAMYRSWHFFRAVVNNAQREMARARLPIASRYAR
LADANGHASPIHDLIAADFERARNALLRITEQEHLLDINPVIQKSITLRNPYTDVLNLLQ
MELLHRYRQASEQERPSLRRALFLSINGIAAAMQSTG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcctcagacgctgcaagaagaaacccgtcaggccggcatcagcgcccccctg
agcgaacacattgcgctcctgggagacatgctgggcgaggcccttcgcgagcaggccggg
ccggacgtcttcgacctcgtgatcgaactgcggcgactctgccgggatgccgagccggat
cggatcgcctccgccttcgccgaagtagcccaccgtatccgcccgctcgacctggaaacc
atcacctggctgctgcgcggctacacggccctgttccacctcatcaacaaggccgaacag
caggagatcatccgcatcaaccgcgagcgggctctccacagtaaccccgacgccccgcgc
cccgaatccatcgccgaggccatccacaccctcaagcagcagggcgcctcgctggacgac
gtgctggcgctgctgcgccgcctcgacatccagcccaccctgacggcgcatcccaccgag
gcgcgtcgccgcagcatcctcttcaagcagcaacgcatcgccgcgctgctgcacaccctg
cgctacggaaagcccaccccggaagaggccgaacgcatcctcgccgagacgcgcaaccag
atccgcctgctgctcgccacggacgaggtccgccccgagcgcctgcacgtcgaggacgag
gtagaacacggcctgtacttcgtccgccataccatctggcataccatcccccgcatctac
cgggacgtccagcaggccctggcgcagtactacgaggcccacgtggacttccccgtcttc
ctgcgttatcgctcctggatcggcagcgaccgggacggcaaccccaacgtgacgccggcc
gtgacgcgccacacgctgctcgtacagcggcgcaccgccctggagctctacctgaccgcg
ctgcgcgacctccgccgggagctgagcgtgtccgaccagcaggtgcccgtcccggacgcg
ttgcgggcgtcgatcgaggccgacgccgcggcgatctcgctcgaccccatccgcctgcgc
cagtaccagcacgaacccttccgcctcaagctgagctacctcatcgcacggctggagcgg
ctgcgcgcccggctggacgctcccgccgcgtcgtcccccgccgaggcctacaccagcacc
gacttcattgccgacctgcgcctgatccgccaatgcctggatgcctgcggcctcggcgaa
gtcgcccactccggtccgctctcggacctgctcgtccaggcgcagaccttcggcttccac
atgatggcgctggacgtacgccagcacagccgcgtccacgaagaggtggtgacgacgctg
ctgcgcctggccggcgtcacggacgactatgcggccctgccagaggccgagcggcagcgg
gtgctctcggccgagctggccaacccgcgccccctggtgccccgcggcaccgacctgccc
gatccggcccgctccgtgatggacaccctgaccgtcatccgggaggccgtcgcgcacgag
ccgctgtccatcggcagctacatcatcagcatgacgcacgaggtcagcgacctgctcgag
gtgatgctgctggccaaagaggccggcatctggcgcatggacggagacaccgtccactgc
ccgatcgacttcgtgccgctcttcgaaaccatcgaggacctgggcgaagccgacgccttc
atggaacggctcttcacgcacccgatctaccggcggcacctcgccgcacgcgggcagttc
caggagatgatgctcggctattcggacagcaacaaggacgggggctactggatggcgaac
tgggcgctgcaccaggcccaggaccgcctcggccgcgtctgccgccgtcacggcatcgac
ttccgcctcttccacgggcgcggcggcacggtcgggcgcggcggcggacgggccaaccag
gccatcctctccatgccctcggcctgccagagcggccgcatccgcttcacggaacagggc
gaggtgatctcgttccgctacgccctctccgacatcgcccggcggcacgtcgagcagatc
gtcaatgccatgatccgtgccaccagccgcccctacgacggcgacgaggcggttcccgtg
gccgagggcgcccccgagcacgccctcatggatcgcatcgccgaccggtcgatggccgcc
taccgtcgcctgatcgaggacccgcgcttctggccctggtatacgaaggccaccccgatc
gagcacatcagccgcctccccatcgcctcccggccggtctctcgcaagaccggtggggag
gtggacttcgagagcctgcgggcgatcccatgggtctttgcctggacgcagacgcgctac
aacgtccccggctggttcggcatcggggaggcgctgcaggcgctgatcgacggcgaaccc
ggcacgctggatcagctccgcgccatgtaccgctcctggcacttcttccgggccgtggtg
aacaacgcccagcgggaaatggcccgcgcccggcttcccattgcctcgcgctatgcccgg
ctcgccgacgccaacggtcacgcctcccccatccatgacctcatcgcggccgacttcgaa
cgggcccggaacgccctcctccgcatcacggagcaggagcacttgctggatatcaacccg
gtgatccagaagtccatcaccctgcggaacccgtacaccgacgtgctcaacctgttgcag
atggagctgctgcaccgctaccgccaggcgtccgagcaggagcggccgtcgctgcgccgg
gcgctgttcctcagcatcaacggcatcgcggccgccatgcagagcaccggttga

DBGET integrated database retrieval system