KEGG   Rhodothermaceae bacterium RA: AWN76_005500
Entry
AWN76_005500      CDS       T04780                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00040  Pentose and glucuronate interconversions
rbar00051  Fructose and mannose metabolism
rbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWN76_005500
   00051 Fructose and mannose metabolism
    AWN76_005500
Enzymes [BR:rbar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AWN76_005500
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ThiF PPR
Other DBs
NCBI-ProteinID: ARA92672
UniProt: A0A1V0DCD4
LinkDB
Position
1327641..1328672
AA seq 343 aa
MKALLHTAPYTLTYTDVEDPVPGPGEVLIRIAACGICGSDVKGYTGTTGRRIPPIIMGHE
AAGTIAAVGPEVSRWQVGDRVCFDSTVYCGTCEACRAGQVNRCVHRQVLGVSVPSFRRHG
AFAEYLALPAHLLLPLPEAVSFAQAALLEPAAIGLHAVRRAGALDGATVAVIGAGPIGLF
ILQAARLAGAERLFVADLQPGRLALARRLGADVPVCPDDEDLLARVREATGGRGVDVAFE
AVGIGPTVRQAIQITRPGGTVVLVGNVQPRVEIDLQDVIARELSLVGSYASSGEYREALE
LVHRGRLQVDPLISEIRPLAEGQAAFDRLYEGTEDLVKIVLTP
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaagccctcctccacaccgccccgtacacgctgacctacaccgacgtcgaggacccc
gtgcccgggccgggcgaggtgctgattcgcatcgccgcctgtggcatctgcggatcggac
gtgaagggctacacggggacgacggggcggcgcatccccccgatcatcatggggcacgag
gccgccggcaccatcgccgccgtcggcccggaggtgagccgctggcaggtgggcgatcgg
gtgtgcttcgactcgacggtctactgcggcacgtgcgaggcctgccgggcgggacaggtc
aaccgctgcgtgcaccgccaggtgctgggggtttcggtgccctccttcaggcggcacggg
gccttcgccgagtacctggccctcccggcccacctgctcctcccgctgccggaggccgtc
tcgttcgcgcaggcggccctgctcgaaccggccgccatcggcctgcacgcggttcgccgc
gccggggcgctcgacggagccaccgtcgcggtgatcggcgccgggccgatcgggctgttc
atcctccaggccgcccgcctcgccggcgccgaacgcctcttcgtggccgacctccagccc
ggccggctcgcgctggcccgccgcctcggggccgacgtcccggtatgccccgacgacgaa
gacctgctcgcccgcgtccgggaagccaccggcggccggggcgtcgacgtcgccttcgaa
gccgtcggcatcggcccgacggtccggcaggcgatccagatcacccggccgggcggcacc
gtggtgctcgtcggcaacgtgcaaccacgcgtggagatcgacctgcaggacgtcatcgcc
cgcgagctgtcgctcgtcggcagctacgccagcagcggcgagtaccgggaggcgctggag
ctcgtccaccggggccgcctccaggtcgacccgctcatcagcgagatccggccgctggcc
gaggggcaggccgccttcgaccgcctctacgaggggacggaagacctcgtcaagatcgtg
ctgacgccctga

DBGET integrated database retrieval system