KEGG   Rhodothermaceae bacterium RA: AWN76_005500Help
Entry
AWN76_005500      CDS       T04780                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
Organism
rbar  Rhodothermaceae bacterium RA
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ThiF PPR AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ARA92672
UniProt: A0A1V0DCD4
LinkDB All DBs
Position
1327641..1328672
Genome map
AA seq 343 aa AA seqDB search
MKALLHTAPYTLTYTDVEDPVPGPGEVLIRIAACGICGSDVKGYTGTTGRRIPPIIMGHE
AAGTIAAVGPEVSRWQVGDRVCFDSTVYCGTCEACRAGQVNRCVHRQVLGVSVPSFRRHG
AFAEYLALPAHLLLPLPEAVSFAQAALLEPAAIGLHAVRRAGALDGATVAVIGAGPIGLF
ILQAARLAGAERLFVADLQPGRLALARRLGADVPVCPDDEDLLARVREATGGRGVDVAFE
AVGIGPTVRQAIQITRPGGTVVLVGNVQPRVEIDLQDVIARELSLVGSYASSGEYREALE
LVHRGRLQVDPLISEIRPLAEGQAAFDRLYEGTEDLVKIVLTP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctcctccacaccgccccgtacacgctgacctacaccgacgtcgaggacccc
gtgcccgggccgggcgaggtgctgattcgcatcgccgcctgtggcatctgcggatcggac
gtgaagggctacacggggacgacggggcggcgcatccccccgatcatcatggggcacgag
gccgccggcaccatcgccgccgtcggcccggaggtgagccgctggcaggtgggcgatcgg
gtgtgcttcgactcgacggtctactgcggcacgtgcgaggcctgccgggcgggacaggtc
aaccgctgcgtgcaccgccaggtgctgggggtttcggtgccctccttcaggcggcacggg
gccttcgccgagtacctggccctcccggcccacctgctcctcccgctgccggaggccgtc
tcgttcgcgcaggcggccctgctcgaaccggccgccatcggcctgcacgcggttcgccgc
gccggggcgctcgacggagccaccgtcgcggtgatcggcgccgggccgatcgggctgttc
atcctccaggccgcccgcctcgccggcgccgaacgcctcttcgtggccgacctccagccc
ggccggctcgcgctggcccgccgcctcggggccgacgtcccggtatgccccgacgacgaa
gacctgctcgcccgcgtccgggaagccaccggcggccggggcgtcgacgtcgccttcgaa
gccgtcggcatcggcccgacggtccggcaggcgatccagatcacccggccgggcggcacc
gtggtgctcgtcggcaacgtgcaaccacgcgtggagatcgacctgcaggacgtcatcgcc
cgcgagctgtcgctcgtcggcagctacgccagcagcggcgagtaccgggaggcgctggag
ctcgtccaccggggccgcctccaggtcgacccgctcatcagcgagatccggccgctggcc
gaggggcaggccgccttcgaccgcctctacgaggggacggaagacctcgtcaagatcgtg
ctgacgccctga

DBGET integrated database retrieval system