KEGG   Rhodothermaceae bacterium RA: AWN76_006890Help
Entry
AWN76_006890      CDS       T04780                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00010  Glycolysis / Gluconeogenesis
rbar00020  Citrate cycle (TCA cycle)
rbar00620  Pyruvate metabolism
rbar01100  Metabolic pathways
rbar01110  Biosynthesis of secondary metabolites
rbar01120  Microbial metabolism in diverse environments
rbar01130  Biosynthesis of antibiotics
rbar01200  Carbon metabolism
Module
rbar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWN76_006890
   00020 Citrate cycle (TCA cycle)
    AWN76_006890
   00620 Pyruvate metabolism
    AWN76_006890
Enzymes [BR:rbar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWN76_006890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N DUF3320 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ARA92915
UniProt: A0A1V0DCZ3
LinkDB All DBs
Position
complement(1660010..1661332)
Genome map
AA seq 440 aa AA seqDB search
MAIPVEMPKMSDTMEEGVLVAWLAEEGDAVSAGDVIAQVETDKATMDLEVYDDGVLLKRV
IDEGDAVPIGGLIAVLGKEGEDISDILAKYQAGAAEAAPSGGDAEAKAAEAADAPATPAG
GDGAPAAQPEPVTATAEGEGRIKASPLARRLAGEHGIDLAAVSGSGPEGRIIKRDIEALI
GAPKAAPARPEPARPEPARPEPRPAEAEPLYEAVPISQMRKTIARRLAESKFTAPHFYLQ
VDVNVEPLVAFRRQLNELAEAQGRAKVSFNDLITKACALALRQHPQVNASYLEKEGEIRQ
YKAVHVAVAVAIDEGLVTPVIRHADQKGLAQIAEETRALAEKARDRKLQPEDYTGSTFTT
SNLGMFGIEEFTAIINPPNACILAIGAIRDVPVVRDGEVVPGKRMKLTLSCDHRIVDGAV
GARFLATLQQYLEEPMNLLL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccattcccgtagaaatgcccaagatgagtgacaccatggaagagggtgtcctcgta
gcatggttggccgaggagggggatgccgtgtcggcgggcgacgtgatcgcccaggtggaa
accgacaaggcgacgatggacctggaagtctatgacgacggggtcctgctcaaacgggtc
atcgacgaaggggacgcggtgcccatcggaggcctcattgccgtgctgggcaaggaggga
gaagacatctcggacatcctggcgaagtaccaggccggcgccgcggaggccgcgccctcg
gggggcgacgccgaggcgaaggcggccgaggcggccgacgcgccggctaccccggccggt
ggggatggcgccccggcggcgcagcccgaacccgtgacggccacggccgagggcgagggg
cgtatcaaggcctcgcccctggcgcgtcggctggccggcgagcatggcatcgacctggcc
gcggtgtccggcagcggaccggaaggccgcatcatcaagcgggacatcgaggcgctgatc
ggggcgccgaaggcggccccggcgcggcccgagcccgcccgccccgagccggcccgtccc
gagcctcggcccgccgaagccgagccgctctacgaggccgtgccgatctcgcagatgcgc
aagaccatcgcccgccgcctggccgagagcaagtttaccgccccgcatttctacctgcag
gtggacgtgaacgtggagccgctggtggccttccgccggcagctcaacgagctggccgag
gcgcagggccgcgccaaggtgtcgttcaacgacctcatcacgaaggcctgtgcgctggcg
ctccggcagcatccgcaggtcaacgcctcctatctggagaaagagggcgagatccggcag
tacaaggccgtgcacgtggccgtcgccgtggccatcgacgaggggctcgtcaccccggtc
atccgccacgccgaccagaaaggcctcgcgcagatcgccgaggagacgcgcgcgctggcc
gagaaagcccgcgaccgcaagctccagccggaggactacacgggctcgaccttcacgacg
agcaacctcggcatgtttggcatcgaggagttcacggccatcatcaacccgccgaacgcc
tgcatcctggccatcggggccatccgggacgtgccggtggtgcgggacggggaggtcgtg
ccgggcaagcgcatgaagctgacgctctcgtgcgatcatcgcatcgtggacggggccgtc
ggtgcgcgcttcctcgctaccctccagcagtacctggaggagccgatgaatctgttgctg
tga

DBGET integrated database retrieval system