KEGG   Rhodothermaceae bacterium RA: AWN76_009665Help
Entry
AWN76_009665      CDS       T04780                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00240  Pyrimidine metabolism
rbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AWN76_009665
Enzymes [BR:rbar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AWN76_009665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ARA93395
UniProt: A0A1V0DEC7
LinkDB All DBs
Position
complement(2370746..2371393)
Genome map
AA seq 215 aa AA seqDB search
MEPFVVHTREKRGWIEVICGSMFSGKTEELIRRLRRARIARLKVEIFKPALDTRYSEAEV
VSHDENALRSIPVDTATQILLLVGEADVVGIDEAQFFDAELVDVCQRLARSGVRVIVSGL
DQDYLGRPFEPMPQLMAVAEYVTKLHAICTVCGAPANHSQRLTPGGARVLLGARDVYEPR
CRRCFQPDPAAPTSAPPPASESQEPSPEALQDEPG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggagccgttcgtcgtacatacccgtgagaagcgaggctggatcgaagtcatctgcggc
tcgatgttcagcgggaagaccgaggagctgatccggcggctccgccgggcccgcatcgcc
cggctgaaggtggagatcttcaagccggcgctcgacacgcgctacagcgaggccgaggtc
gtctcgcacgatgagaatgccctgcggtccatcccggtcgacaccgcgacgcagatcctc
ctgctcgtgggggaggctgacgtggtgggcatcgacgaagcccagttcttcgatgccgaa
ctcgtcgacgtgtgccagcggctcgcgcgcagcggggtgcgggtgatcgtcagcgggctc
gaccaggattacctcgggcgtccgttcgagccgatgccgcagctgatggccgtggccgag
tacgtcaccaagctccacgccatctgcacggtctgcggtgcgccggccaaccactcgcag
cgcctgacccccggcggggcgcgggtgctgctcggggcgcgggacgtctacgaaccccgc
tgccggcggtgcttccagcccgacccggcagcgccgacgtccgctcccccgccggcttcc
gaaagccaggagccctcgcccgaggcgctacaggacgagccgggttga

DBGET integrated database retrieval system