KEGG   Rhodothermaceae bacterium RA: AWN76_010190
Entry
AWN76_010190      CDS       T04780                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00564  Glycerophospholipid metabolism
rbar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWN76_010190
Enzymes [BR:rbar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWN76_010190
SSDB
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA NAD_binding_8 FAD_binding_3 HI0933_like Pyr_redox_3 Pyr_redox_2 Pyr_redox
Other DBs
NCBI-ProteinID: ARA93488
UniProt: A0A1V0DET4
LinkDB
Position
2493043..2494632
AA seq 529 aa
MNRDAMMAALEDGARVWDLLVIGGGATGLGCAIDAASRGYDTLLLEQHDFAKGTSSRSTK
LVHGGVRYLKQGNIALVLEALKERGLLLKNAPHLVRNLAFIVPNYDWWEGPFYGIGLKMY
DLLAGKQGFGRSKTLSREKTMEHIPTLEPEGLIGGVIYYDGQFDDARLAINMAQTAAEQG
AVLLNYMRVTGLVKEHGEVRGVEAIDQETGTAYTLRARAVINATGVFTDGIRRLDDPDAP
PMISPSQGVHLVLDRSFLPGSTAIMVPKTDDGRVLFAIPWHDRVVVGTTDTPVEEASLEP
RAFDEEIAFILTHAARYLTKDPAPEDVLSVFAGLRPLVGSAEDEDTASLSRDHTLHISKS
GLVTITGGKWTTYRKMAEDTIDQAATLAELEERPSPTRDLPIHGYHHHAEEFGPLQDYGS
DAPALQNLMRERPALREALHPNHPVVAAQVVWAVRHEMARTVEDVLARRTRLLLLDARAS
IEMAPKVAALMAAELSRDDAWQQAQIEQYRTVAEGYLIAPDQATRLTAS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaaccgtgacgccatgatggccgcgctggaagacggcgcccgtgtgtgggatctgctc
gtcatcggcggcggcgccaccgggctcggctgcgccatcgacgcagcctcgcgcggctac
gacacactgctgctcgaacagcacgacttcgccaagggcacctccagccggagcacgaag
ctggtgcacggcggggtgcgctacctcaagcagggcaacatcgccctcgtcctggaggcc
ctcaaggagcgcgggctgctgctcaagaacgccccccacctcgtccgcaacctggccttc
atcgtccccaactacgactggtgggaagggccgttctacggcatcgggttgaagatgtac
gacctgctggccggcaagcagggcttcggccggtcgaagaccctctcccgcgagaaaacg
atggagcacatcccgacgctggagccggagggcctcatcggcggggtgatctactacgac
ggtcagttcgacgacgcccgcctggccatcaacatggcgcagactgccgccgaacagggc
gccgtgcttctcaactacatgcgcgtcaccggcctcgtcaaggagcacggcgaggtgcgc
ggcgtcgaggccatcgaccaggaaaccggcaccgcctacacgctccgcgcccgggccgtc
atcaacgccacgggcgtcttcaccgacggcatccgccgcctggacgacccggacgccccc
ccgatgatctcgcccagccagggcgtgcacctcgtgctcgaccgctcgttcctgcccggc
tcgacggccatcatggtgcccaaaaccgacgacggccgggtgctctttgccatcccctgg
cacgaccgcgtcgtcgtcggcaccaccgatacgccggtcgaggaagcctcgctggagccg
cgggccttcgacgaggagatcgccttcatcctcacccatgcggcccgctacctgaccaag
gaccccgccccggaagacgtgctgagtgtctttgccgggctccggccgctcgtcggctcg
gcagaggacgaggacaccgcctcgctctcgcgcgaccacacgctgcacatctcgaagtcg
ggcctggtgaccatcaccggcggcaagtggacgacctaccggaagatggcggaggatacg
atcgaccaggcggcgacgctggcggagctggaggagcgaccctcaccgacgcgggaccta
cccatccacggctaccatcaccacgccgaggaattcggccctctgcaggattacggctcg
gacgcaccggccctgcagaacctgatgcgggagcgtccggcgctgcgcgaagccctccac
ccgaaccacccggtcgtggcggcgcaggtggtctgggccgtgcgccacgagatggcccgc
acggtggaggacgtcctggcccgccgcacccgcctgctgctgctcgacgcccgcgccagc
atcgagatggcgccgaaggtggccgcgctcatggccgccgagctgagccgcgacgacgcc
tggcagcaggcccagatcgaacagtaccgcaccgtggccgagggctacctgatcgccccc
gaccaggccacccgcctgaccgcttcctga

DBGET integrated database retrieval system