KEGG   Rhodothermaceae bacterium RA: AWN76_010860Help
Entry
AWN76_010860      CDS       T04780                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00473  D-Alanine metabolism
rbar00550  Peptidoglycan biosynthesis
rbar01100  Metabolic pathways
rbar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWN76_010860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AWN76_010860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AWN76_010860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbar01011]
    AWN76_010860
Enzymes [BR:rbar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AWN76_010860
Peptidoglycan biosynthesis and degradation proteins [BR:rbar01011]
 Precursor biosynthesis
  Amino acid ligase
   AWN76_010860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C TTL ATP-grasp_4 ATPgrasp_YheCD ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ARA93608
UniProt: A0A1V0DF58
LinkDB All DBs
Position
2651134..2652141
Genome map
AA seq 335 aa AA seqDB search
MRIGLIYDVFDAYPWQDGEPPDADAEYEPEATVEALEAAIRTLGHEPVRIGTAHDLLRAL
PSLHLDAAVNIAEGARSRNREAYAPILLEMAGIPFLGADALTLSLTLDKAWTKDLAAAAD
VPTPPYRTYSHADAIDPADLPGPFPLFVKPRYEGSSKGITAASKVTSLEALREQVAWCTA
TYRQDALVEPFIDGGGEFTVAIIGHDPPEALPVLQRAVETTTGIGLHALEHRGLPARPYD
YTLGGTLDPALEAELHRLTRRLFDKLLCRDFARADFRVDADGRPWFLEINPLPTFDPTGT
FAILAELTGQPYPAFLADVLRRGLHRLGLTDLTSC
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggcctgatctacgacgtgttcgacgcctacccgtggcaggacggcgaaccg
cccgacgccgacgcggaatacgaaccggaagcgaccgtcgaggccctggaggccgccatc
cgcacgctggggcacgagccggtccgcatcggcacggcgcacgacctgctgcgggcgctg
ccgtcgctgcacctggacgcagccgtcaacatcgccgagggggcccgcagccgcaaccgc
gaggcgtacgccccgattctgctggagatggcgggcatccccttcctcggggccgacgcg
ctgaccctctcgctcacgctcgacaaagcctggacgaaggacctggcggccgctgccgac
gtcccgaccccgccctaccgcacctactcgcatgccgacgccatcgacccggccgacctc
cccgggccgtttccgctgttcgtcaagccccgctacgaaggctcctccaaaggcatcacc
gccgcgagcaaggtgacctcgctggaggccctgcgggagcaggtggcctggtgcaccgca
acgtaccggcaggacgcgctcgtggagccgttcatcgacggcggcggcgagttcaccgtc
gccatcatcggccacgacccgcccgaggccctgcccgtgctgcaacgcgccgtcgagacg
acgaccggcatcggcctgcacgcgctggagcaccgcgggctgccggcccggccctacgac
tacaccctcggcggcaccctcgaccccgccctcgaagccgaactgcatcgcctgacgcgg
cgcctgttcgacaagctcctgtgccgggacttcgcccgcgccgacttccgcgtcgatgcc
gacggacgcccctggttcctcgaaatcaaccccctgcccacgttcgacccgaccgggacc
ttcgccatcctggccgagttgaccgggcaaccctacccggccttcctcgccgacgtgctc
cgccgcgggctgcatcggctcggcctgaccgacctcacctcgtgctga

DBGET integrated database retrieval system