KEGG   Rhodothermaceae bacterium RA: AWN76_014560Help
Entry
AWN76_014560      CDS       T04780                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00010  Glycolysis / Gluconeogenesis
rbar00052  Galactose metabolism
rbar01100  Metabolic pathways
rbar01110  Biosynthesis of secondary metabolites
rbar01120  Microbial metabolism in diverse environments
rbar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWN76_014560
   00052 Galactose metabolism
    AWN76_014560
Enzymes [BR:rbar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AWN76_014560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ARA94252
UniProt: A0A1V0DGV1
LinkDB All DBs
Position
3604868..3606019
Genome map
AA seq 383 aa AA seqDB search
MHVRVHRILGTLLAGLFLNACSPSSQPPTTMLTQTPFGTTADGEAVTMYTLTRAGGMEVR
LLNYGGIITSLKVPDRNGRLEDVVLGFDTLAPYLERHPYFGAIIGRYGNRIAGGQFTLDG
TTYTLAQNDGPNHLHGGLRGFDRVVWQAEPFEEPGRVGVVLTYTSPDGEEGYPGTLQAKV
TYTLTDDDELIVDYEATTDKATPVNLTQHTYFNLAGHDSGDVLDHELTIHADHYLPVDST
LIPTGERRPVAGTPFDFRRPTPIGARIEADDPQLHWGPGGYDHTFVLNRTGDGLEPAARV
YEPTSGRVLEVRTTEPGVQFYSGNFLDGSLVGKGGAVYARHAGFCLETQHFPNSPNQPDF
PSTILRPGETYSSRTVFAFSVQD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgggttcatcgcatcctcgggacgctgctggccgggctgtttctgaatgcc
tgctcgccgtcctcgcagccgcctaccaccatgctcacgcaaacgcctttcggcaccacg
gccgacggggaggccgtcacgatgtacacgctcactcgggccggcggcatggaggtccgc
ctcctgaactacggcgggatcatcacgtcgctgaaagtgccggaccgaaacggacggctg
gaggacgtcgtgctcggcttcgacacgctggcgccctacctggagcgccatccctacttc
ggcgccatcatcggccgctacggtaaccgcatcgccggggggcagttcacgctggacggt
acgacatacacgctggcccagaacgacggccccaaccacctccacggcggcctcaggggg
ttcgaccgggtggtctggcaggccgagccgttcgaggagccgggccgcgtcggggtggtc
ctgacctataccagcccggacggcgaggagggataccccggcacgctccaggcgaaggtc
acctacacgctgaccgacgacgacgaactgatcgtcgactacgaggcgacgacggacaag
gccacgccggtcaacctcacgcagcatacctacttcaacctggccggccacgatagcggc
gacgtcctggatcacgaactgacgatccacgccgatcactacctgccggtcgacagcacg
ctgatccccaccggcgagcggcgcccggtggcgggcacacccttcgacttccgccggccg
acgcccatcggcgcgcgcatcgaggcggacgatccgcagttgcactgggggccgggcggc
tatgaccacacgttcgtcctgaaccgcaccggggacggcctggagccagcggcccgcgtc
tacgagccgaccagcggacgcgtcctggaggttcgcaccaccgagccgggcgtgcagttc
tattccggcaatttcctcgacggctcgctggtcggcaagggcggggccgtctatgcccgg
catgccggcttctgcctcgaaacccagcacttcccgaactcccccaaccagcccgacttc
cccagcaccatcctgcgtcccggggagacctactcctcgcgtacggtcttcgccttttcc
gtacaggattga

DBGET integrated database retrieval system