KEGG   Rhodothermaceae bacterium RA: AWN76_015370
Entry
AWN76_015370      CDS       T04780                                 

Definition
(GenBank) hypothetical protein
Organism
rbar  Rhodothermaceae bacterium RA
SSDB
Motif
Pfam: NTP_transf_5 MdcG DUF2063 DUF2007
Other DBs
NCBI-ProteinID: ARA94393
UniProt: A0A1V0DHA5
LinkDB
Position
3819004..3820182
AA seq 392 aa
MTARPPRMTTAYELVRCSLQVAWNPAAREQLPERAAGVDWEEVVRVAETEGVWTEVSRTL
LATEGVVVPKALVRPWTLQHARLKLRRAEQAAAAAALVDHLAARGIPSLVLKGIVLEQQV
YGETGWRATSDIDLLVDEARFAETEQALFEAGYGYPGDRRRPDGAVAGANPRRHIKEAVL
YLFGERAYVSDETTEVTIDLHVLPLDRRFTFRRAFEALYADRRHVTVEQHALPTLSLPDT
MIYTAYRGLDSAWRLKYTRDMAGLIHRHEVDWPALAAHARRCGAQRVLAYMLGEVQQRLG
LPLPPAARALVDPDWWQAMAVRYGQDRRAQEPGWYRLRRYLAFMDDTRARMRFLWFVGLH
RGVYEPVVALRRLLQPVRPSPVLDRPGVDRPG
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgacggcccgacccccgcgcatgacgaccgcgtacgaactggtgcgatgcagcctgcag
gtggcctggaacccggccgcccgcgagcagctgcccgaacgggccgccggggtggactgg
gaggaggtcgtccgcgtggccgagacggaaggcgtgtggacggaggtctcgcgcacgctg
ctggctaccgaaggggtggtcgtgccgaaagcgctggtgcggccctggacgctgcaacat
gcccgcctcaagctgcgccgtgccgagcaggccgccgccgcggccgccctcgtcgatcac
ctggccgcccgcggcatcccgtcgctggtcctcaaaggcatcgtcctggagcagcaggtc
tacggcgagaccggctggcgggccacgtccgacatcgacctgctcgtggacgaggcccgt
ttcgccgagacggagcaggcgctgttcgaggccgggtatggctatcccggagatcgccgc
cgacccgacggggccgtcgccggggccaatccgcgtcgtcacatcaaggaagccgtcctg
tacctgttcggcgagcgcgcgtacgtctcggacgagacgaccgaggtgaccatcgacctg
cacgtgttgccgctcgaccggcgcttcacgtttcgccgggccttcgaggcgctgtatgcc
gaccgtcggcacgtcaccgtcgagcagcacgccctgccgacgctcagcctgcccgatacg
atgatctacacggcgtaccgggggctggatagcgcctggcggctcaaatacacccgcgat
atggccggcctgatccatcggcacgaggtcgactggccggcgctcgcggcgcacgcccgc
cgctgcggcgcgcagcgggtgttggcatacatgctgggcgaggtccagcagcgcctcggc
ctgccgctgccgcccgccgcccgcgccctcgtcgacccggactggtggcaggcgatggcg
gtacgctatggccaggaccgccgcgcgcaggagccgggctggtatcgcctccgccggtac
ctggccttcatggacgatacccgcgcccggatgcggtttctctggttcgtcggcctgcac
cggggcgtgtatgaacccgtcgtggcgctgcgtcgtctcctgcagcccgtgcggccttcg
cccgtcctggaccgccccggcgtcgaccggccgggctga

DBGET integrated database retrieval system