KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108511997
Entry
108511997         CDS       T04641                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108511997
   04020 Calcium signaling pathway
    108511997
   04072 Phospholipase D signaling pathway
    108511997
   04151 PI3K-Akt signaling pathway
    108511997
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108511997
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108511997
   04613 Neutrophil extracellular trap formation
    108511997
   04650 Natural killer cell mediated cytotoxicity
    108511997
   04662 B cell receptor signaling pathway
    108511997
   04664 Fc epsilon RI signaling pathway
    108511997
   04666 Fc gamma R-mediated phagocytosis
    108511997
   04672 Intestinal immune network for IgA production
    108511997
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108511997
  09163 Immune disease
   05310 Asthma
    108511997
   05322 Systemic lupus erythematosus
    108511997
   05323 Rheumatoid arthritis
    108511997
   05320 Autoimmune thyroid disease
    108511997
   05330 Allograft rejection
    108511997
   05340 Primary immunodeficiency
    108511997
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108511997
   05416 Viral myocarditis
    108511997
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108511997
   05150 Staphylococcus aureus infection
    108511997
   05152 Tuberculosis
    108511997
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108511997
   05169 Epstein-Barr virus infection
    108511997
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108511997
   05140 Leishmaniasis
    108511997
   05143 African trypanosomiasis
    108511997
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108511997
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108511997
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 108511997
NCBI-ProteinID: XP_017702545
LinkDB
Position
Un
AA seq 131 aa
MDLLCKNMKHLWFFLLLVAAPRWVLSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYG
WGWIRQPPGKGLEWIGYIYGSSGNTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAV
YYCARDTVRGD
NT seq 396 nt   +upstreamnt  +downstreamnt
atggatctcctgtgtaagaacatgaagcacctgtggttcttcctcctcctggtggcagct
cccagatgggtcctgtcccaggtgcagctgcaggagtccggcccaggagtggtgaagcct
tcggagaccctgtccctcacctgcgctgtctctggttactccatcagcagtggttatggc
tggggctggatccgccagcccccagggaagggactggagtggattgggtatatctatggt
agtagtgggaacacctactacaacccctccctcaagagtcgagtcaccatttcaaaagac
acgtccaagaaccagttctccctgaagctgagctctgtgaccgccgcggacacggccgtg
tattactgtgcgagagacacagtgaggggagactag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512001
Entry
108512001         CDS       T04641                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108512001
   04020 Calcium signaling pathway
    108512001
   04072 Phospholipase D signaling pathway
    108512001
   04151 PI3K-Akt signaling pathway
    108512001
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108512001
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108512001
   04613 Neutrophil extracellular trap formation
    108512001
   04650 Natural killer cell mediated cytotoxicity
    108512001
   04662 B cell receptor signaling pathway
    108512001
   04664 Fc epsilon RI signaling pathway
    108512001
   04666 Fc gamma R-mediated phagocytosis
    108512001
   04672 Intestinal immune network for IgA production
    108512001
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108512001
  09163 Immune disease
   05310 Asthma
    108512001
   05322 Systemic lupus erythematosus
    108512001
   05323 Rheumatoid arthritis
    108512001
   05320 Autoimmune thyroid disease
    108512001
   05330 Allograft rejection
    108512001
   05340 Primary immunodeficiency
    108512001
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108512001
   05416 Viral myocarditis
    108512001
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108512001
   05150 Staphylococcus aureus infection
    108512001
   05152 Tuberculosis
    108512001
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108512001
   05169 Epstein-Barr virus infection
    108512001
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108512001
   05140 Leishmaniasis
    108512001
   05143 African trypanosomiasis
    108512001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108512001
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108512001
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 108512001
NCBI-ProteinID: XP_017702547
LinkDB
Position
Un
AA seq 128 aa
MDILCKNMKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSVGSNWW
GWIRQAPGKGLEWIGHIHYSGSSYLNPSLKSRVTLSVDKSKNQFSLKLSSVTAADTAVYY
CARHSEGR
NT seq 387 nt   +upstreamnt  +downstreamnt
atggacatcctgtgcaagaacatgaagcacctgtggttcttcctcctcctggtggcagct
cccagatgggtcctgtcccaggtgcagctgcaggagtcgggcccaggactggtgaagcct
tcggagaccctgtccctcacctgcgctgtctctggaggctccgtgggcagtaactggtgg
ggctggatccgccaggccccagggaagggactggagtggattgggcatatccattatagt
gggagcagctaccttaacccgtccctcaagagccgagtcaccctgtcagtagacaagtcc
aagaaccagttctccctgaagctgagctctgtgaccgccgcggacacggccgtgtattac
tgtgcgagacacagtgaggggaggtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519975
Entry
108519975         CDS       T04641                                 

Definition
(RefSeq) uncharacterized LOC108519975
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108519975
   04020 Calcium signaling pathway
    108519975
   04072 Phospholipase D signaling pathway
    108519975
   04151 PI3K-Akt signaling pathway
    108519975
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519975
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519975
   04613 Neutrophil extracellular trap formation
    108519975
   04650 Natural killer cell mediated cytotoxicity
    108519975
   04662 B cell receptor signaling pathway
    108519975
   04664 Fc epsilon RI signaling pathway
    108519975
   04666 Fc gamma R-mediated phagocytosis
    108519975
   04672 Intestinal immune network for IgA production
    108519975
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108519975
  09163 Immune disease
   05310 Asthma
    108519975
   05322 Systemic lupus erythematosus
    108519975
   05323 Rheumatoid arthritis
    108519975
   05320 Autoimmune thyroid disease
    108519975
   05330 Allograft rejection
    108519975
   05340 Primary immunodeficiency
    108519975
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108519975
   05416 Viral myocarditis
    108519975
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108519975
   05150 Staphylococcus aureus infection
    108519975
   05152 Tuberculosis
    108519975
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108519975
   05169 Epstein-Barr virus infection
    108519975
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108519975
   05140 Leishmaniasis
    108519975
   05143 African trypanosomiasis
    108519975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108519975
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108519975
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 108519975
NCBI-ProteinID: XP_017714754
LinkDB
Position
Un
AA seq 247 aa
MSERNSEYVWQFLTKHSVFAGVQCEVQLMESEGGLVQPGGSLRLSCAASGFTFSGSAMHW
VRQASGKGLEWVGPLRAEPSPRILRCFHLVISAKHRRLTKEFVLSWVFLAAILKGVQCEV
QLVESGGGLVQPEGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVGLIKNKANSYKTEY
AASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCARDTVRGGQCEPRRKPPCRGVWGH
QGALGTH
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagtgagagaaacagtgagtatgtgtggcagtttctgaccaaacactctgtgtttgca
ggtgtccagtgtgaggtgcagctgatggagtctgagggaggcctggtccagcctggcggg
tccctgagactctcctgtgcagcctctggattcaccttcagtggttctgctatgcactgg
gtccgccaggcttctgggaaaggactggagtgggttggacctctgagagcagagcccagc
ccccgaattctcaggtgttttcatttggtgatcagcgccaaacacagaagactcaccaag
gagtttgtcctgagctgggttttccttgctgctattttaaaaggtgtccagtgtgaggtg
cagctggtggagtctgggggaggcttggtccagcctgaggggtccctgagactctcctgt
gcagcctctggattcaccttcagtagctactacatgcactgggtccgccaggctccaggg
aaggggctggagtgggttggccttattaaaaacaaagctaacagttacaagacagaatac
gccgcgtctgtgaaaggcagattcaccatctcaagggatgattcaaagaacacactgtac
ctgcaaatgagcagcctgaaaaccgaggacacggccgtgtattactgtgctagagacaca
gtgaggggaggtcagtgcgagcccagacgcaaacctccctgcaggggcgtgtggggccac
cagggggcgctcgggacccactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519976
Entry
108519976         CDS       T04641                                 

Definition
(RefSeq) uncharacterized LOC108519976
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108519976
   04020 Calcium signaling pathway
    108519976
   04072 Phospholipase D signaling pathway
    108519976
   04151 PI3K-Akt signaling pathway
    108519976
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519976
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519976
   04613 Neutrophil extracellular trap formation
    108519976
   04650 Natural killer cell mediated cytotoxicity
    108519976
   04662 B cell receptor signaling pathway
    108519976
   04664 Fc epsilon RI signaling pathway
    108519976
   04666 Fc gamma R-mediated phagocytosis
    108519976
   04672 Intestinal immune network for IgA production
    108519976
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108519976
  09163 Immune disease
   05310 Asthma
    108519976
   05322 Systemic lupus erythematosus
    108519976
   05323 Rheumatoid arthritis
    108519976
   05320 Autoimmune thyroid disease
    108519976
   05330 Allograft rejection
    108519976
   05340 Primary immunodeficiency
    108519976
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108519976
   05416 Viral myocarditis
    108519976
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108519976
   05150 Staphylococcus aureus infection
    108519976
   05152 Tuberculosis
    108519976
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108519976
   05169 Epstein-Barr virus infection
    108519976
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108519976
   05140 Leishmaniasis
    108519976
   05143 African trypanosomiasis
    108519976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108519976
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108519976
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 108519976
NCBI-ProteinID: XP_017714755
LinkDB
Position
Un
AA seq 406 aa
MELGLSWVFLLLAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYHMTWVRQA
PGKGLEWVGFIRNKASGGTAEYAASVKGRFAISRDDSKSITYLQMNSLKTEDTAVYYCAR
NTVRGGQCEPRHKPPCRARGATRGRSGPTEDVQVSLDFLHSPPAPLPSEGFWEWLLDGQK
QMPHTHMLGQKDFVTVYILEKEVKRIGKLFSLWSLRNSHYNTFFTLDFKQSIVHVCLYLR
NLGLGIPRHFLGVTSPERRGLTMELGLSWVFLVAVLGGVQCEVQLVESXGGLVQPGGSLR
LSCAASGFTFSSYWMSWVRQAPGKGPEWVSDISGSTIYYADSVKGRFTVSRDDAKNSLSL
QMDSLRAEDTAVYYCAREDTVRGGQCEPRHKPPCRGPHDHQGRPGH
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggagttggggctgagctgggttttccttcttcttgctattttaaaaggtgtccagtgt
gaggtgcagctggtggagtctgggggaggcttggtccagcctggcgggtccctgagactc
tcctgtgcagcctctggattcaccttcagtaactaccacatgacctgggtccgccaggct
ccaggaaaggggctggagtgggtaggtttcattagaaacaaagctagtggtgggacagca
gaatacgccgcgtctgtgaaaggcagattcgccatctccagagatgattccaaaagcatc
acctatctgcaaatgaacagcctgaaaaccgaggacacggccgtgtattactgtgcgagg
aacacagtgaggggaggtcagtgtgagcccagacacaaacctccctgcagggcgcgcggg
gccaccagggggcgctcgggacccactgaggacgtgcaggtctcattggattttctccac
agtccacctgcacccttgccttctgaaggcttctgggagtggctgctggatgggcagaag
cagatgcctcatacacacatgttgggacagaaagattttgtgactgtctacattttggaa
aaggaagtcaagaggataggaaaactcttcagtctgtggtcccttagaaattcacactac
aacacatttttcacccttgacttcaagcaatccattgtacatgtgtgtttatatcttagg
aaccttggccttgggattccaaggcatttcctcggggtgaccagccctgaacgcagagga
ctcaccatggagttggggctgagctgggttttccttgttgctgttttaggaggtgtccag
tgtgaggtgcagctggtggagtctnggggaggcttggtccagcctggagggtccctgaga
ctctcctgtgcagcctctggattcaccttcagcagctactggatgagctgggtccgccag
gctccgggaaaggggccggagtgggtttcagacatttctggtagtaccatatactacgca
gattccgtgaagggccgattcaccgtctccagagacgacgccaagaactcgctgtctctg
caaatggacagcctgagagccgaggacacggccgtgtattactgtgcgagagaggacacg
gtgcggggaggtcagtgtgagcccagacacaaacctccctgcaggggtccccacgaccac
caggggcgcccgggacactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519983
Entry
108519983         CDS       T04641                                 

Definition
(RefSeq) uncharacterized LOC108519983
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108519983
   04020 Calcium signaling pathway
    108519983
   04072 Phospholipase D signaling pathway
    108519983
   04151 PI3K-Akt signaling pathway
    108519983
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519983
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519983
   04613 Neutrophil extracellular trap formation
    108519983
   04650 Natural killer cell mediated cytotoxicity
    108519983
   04662 B cell receptor signaling pathway
    108519983
   04664 Fc epsilon RI signaling pathway
    108519983
   04666 Fc gamma R-mediated phagocytosis
    108519983
   04672 Intestinal immune network for IgA production
    108519983
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108519983
  09163 Immune disease
   05310 Asthma
    108519983
   05322 Systemic lupus erythematosus
    108519983
   05323 Rheumatoid arthritis
    108519983
   05320 Autoimmune thyroid disease
    108519983
   05330 Allograft rejection
    108519983
   05340 Primary immunodeficiency
    108519983
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108519983
   05416 Viral myocarditis
    108519983
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108519983
   05150 Staphylococcus aureus infection
    108519983
   05152 Tuberculosis
    108519983
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108519983
   05169 Epstein-Barr virus infection
    108519983
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108519983
   05140 Leishmaniasis
    108519983
   05143 African trypanosomiasis
    108519983
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108519983
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108519983
SSDB
Motif
Pfam: V-set Ig_3 Inhibitor_I68
Other DBs
NCBI-GeneID: 108519983
NCBI-ProteinID: XP_017714756
LinkDB
Position
Un
AA seq 284 aa
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPLETLSLTCAVSGGSISDGYYWSWIRQP
PGKGLEWIGRIYGSSGSTDYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCARDT
VRGGECEPRHKPPCREAEGAGAGAAQDQQGARGAHRAGGRVRSRCREGGASSSAQCSPSS
PAPQLVVLLKILVDQDARQVLETLSQEHPADIRGTCWTLTWDISSHFLRVTNVLWLVPDG
TRMGSRHPVSVMKSDGSRNHPCGLHVNQMWVHSEEYVLWVLAFQ
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtggcagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcgggcccaggactggtgaagcctttggagaccctgtccctcacc
tgcgctgtctctggtggctctatcagcgatggttactactggagctggatccgccagccc
ccagggaaggggctggagtggattgggcgtatctatggtagtagtgggagcaccgactac
aacccctccctcaagagtcgagtcaccatttcaaaagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagagacaca
gtgaggggaggtgagtgtgagcccagacacaaacctccctgcagggaggcggagggggcg
ggcgcaggtgccgctcaggaccagcagggggcgcgcggggcccacagagcaggaggccgg
gtcaggagcaggtgcagggagggcggggcttcctcatctgctcagtgctctccctcctca
ccagcacctcagctggtggttctactgaaaatcctggtggatcaagatgccaggcaggtg
ctggagacactgtctcaggagcacccagcagatatcagagggacctgctggacgctcacg
tgggacatcagcagtcactttctcagagtcaccaatgtgctgtggctggtgcctgatggg
accaggatggggtcacggcacccggtcagtgtcatgaagagtgatggttccagaaatcat
ccatgtggtctccatgttaatcaaatgtgggttcacagtgaggagtatgtcctctgggtg
cttgcttttcagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108519992
Entry
108519992         CDS       T04641                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108519992
   04020 Calcium signaling pathway
    108519992
   04072 Phospholipase D signaling pathway
    108519992
   04151 PI3K-Akt signaling pathway
    108519992
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108519992
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108519992
   04613 Neutrophil extracellular trap formation
    108519992
   04650 Natural killer cell mediated cytotoxicity
    108519992
   04662 B cell receptor signaling pathway
    108519992
   04664 Fc epsilon RI signaling pathway
    108519992
   04666 Fc gamma R-mediated phagocytosis
    108519992
   04672 Intestinal immune network for IgA production
    108519992
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108519992
  09163 Immune disease
   05310 Asthma
    108519992
   05322 Systemic lupus erythematosus
    108519992
   05323 Rheumatoid arthritis
    108519992
   05320 Autoimmune thyroid disease
    108519992
   05330 Allograft rejection
    108519992
   05340 Primary immunodeficiency
    108519992
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108519992
   05416 Viral myocarditis
    108519992
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108519992
   05150 Staphylococcus aureus infection
    108519992
   05152 Tuberculosis
    108519992
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108519992
   05169 Epstein-Barr virus infection
    108519992
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108519992
   05140 Leishmaniasis
    108519992
   05143 African trypanosomiasis
    108519992
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108519992
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108519992
SSDB
Motif
Pfam: V-set Ig_3 ig
Other DBs
NCBI-GeneID: 108519992
NCBI-ProteinID: XP_017714758
LinkDB
Position
Un
AA seq 127 aa
MDLLCKNMKHLWFFLLLVAAPRWVLSQVQLQQWGEGLVKPSETLSLTCAVSGGSISSYWW
SWIRQPPGKGLEWIGEINGNGGSTNYNPSLKSRRVTIFNRARQDRSLPLKLSSVTRLRTT
AVYYCTR
NT seq 384 nt   +upstreamnt  +downstreamnt
atggacctcctgtgcaagaacatgaagcacctgtggttcttcctcctcctggtggcagct
cccagatgggtcctgtcccaggtgcagctacaacagtggggcgaaggactggtgaagcct
tcggagaccctgtccctcacctgcgctgtctctggtggctccatcagcagttactggtgg
agctggatccgccagcccccagggaagggactggagtggattggggagatcaatggtaat
ggtgggagcaccaactacaacccgtccctcaagagtcgtcgagtcaccattttcaataga
gcacgccaagaccgcagtctcccgctgaagctgagctctgtgacccgcctgcggacaacg
gccgtgtattactgtacgagataa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520828
Entry
108520828         CDS       T04641                                 

Definition
(RefSeq) uncharacterized LOC108520828
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108520828
   04020 Calcium signaling pathway
    108520828
   04072 Phospholipase D signaling pathway
    108520828
   04151 PI3K-Akt signaling pathway
    108520828
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108520828
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108520828
   04613 Neutrophil extracellular trap formation
    108520828
   04650 Natural killer cell mediated cytotoxicity
    108520828
   04662 B cell receptor signaling pathway
    108520828
   04664 Fc epsilon RI signaling pathway
    108520828
   04666 Fc gamma R-mediated phagocytosis
    108520828
   04672 Intestinal immune network for IgA production
    108520828
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108520828
  09163 Immune disease
   05310 Asthma
    108520828
   05322 Systemic lupus erythematosus
    108520828
   05323 Rheumatoid arthritis
    108520828
   05320 Autoimmune thyroid disease
    108520828
   05330 Allograft rejection
    108520828
   05340 Primary immunodeficiency
    108520828
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108520828
   05416 Viral myocarditis
    108520828
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108520828
   05150 Staphylococcus aureus infection
    108520828
   05152 Tuberculosis
    108520828
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108520828
   05169 Epstein-Barr virus infection
    108520828
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108520828
   05140 Leishmaniasis
    108520828
   05143 African trypanosomiasis
    108520828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108520828
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108520828
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 108520828
NCBI-ProteinID: XP_017715861
LinkDB
Position
Un
AA seq 277 aa
MEFGLSWVFLVAILKGVQCEVQLVESGGGLVQPAGSLRLSCVGSGFTFSSYGMHWARQAP
GKGLEWVSAINSGGGSTWYADSVKGRFTISRENARNTLYLQMDSLRAEDTAVYYCAKDTV
RRSQCEPRHKPPCRNAEGKSVAGGAQDPLIRVNPRGRCRWRLISCQDIDAYRNEKSSTMV
TRIRVLRKLRASWHPSPYLAVEEETSKEGLLSSDENQPSPCSVAQKEERQFDSQVLPLGV
QCELLLVESGGDLVQPVGALRLSCAASGSTFSSYWIS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggagtttgggctgagctgggttttccttgttgctattttaaaaggtgtccagtgtgag
gtgcagctggtggagtctgggggaggcttggtacagcctgcggggtccctgagactctcc
tgtgtaggctctggattcaccttcagtagctatggcatgcactgggcccgccaggctccg
gggaaggggctggagtgggtctcagctattaatagtggtgggggtagcacatggtacgca
gactccgtgaagggcagattcaccatctccagagagaatgccaggaacacactgtatctt
caaatggacagcctgagagctgaggacacggctgtctattactgtgcgaaagacacagtg
aggagaagtcagtgtgagcccagacacaaacctccctgcaggaacgctgaggggaaatca
gttgcagggggtgctcaggacccactgatcagagtcaaccccagaggcaggtgcagatgg
aggctgatttcctgtcaggatattgatgcttacagaaatgaaaagtcctcaaccatggtc
accagaatcagagtcctgaggaagctcagggcttcctggcatccatccccatatcttgct
gtagaggaggagaccagcaaagagggccttctctcttctgatgaaaaccagcccagccca
tgttctgtagctcagaaagaagagcgccagtttgattcccaggtgcttccacttggtgtc
cagtgtgagttgctgctggtggagtctgggggagatttggtacagcccgtgggggccctg
agactctcctgtgcagcctctggatccaccttcagtagttactggatcagctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522153
Entry
108522153         CDS       T04641                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108522153
   04020 Calcium signaling pathway
    108522153
   04072 Phospholipase D signaling pathway
    108522153
   04151 PI3K-Akt signaling pathway
    108522153
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108522153
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108522153
   04613 Neutrophil extracellular trap formation
    108522153
   04650 Natural killer cell mediated cytotoxicity
    108522153
   04662 B cell receptor signaling pathway
    108522153
   04664 Fc epsilon RI signaling pathway
    108522153
   04666 Fc gamma R-mediated phagocytosis
    108522153
   04672 Intestinal immune network for IgA production
    108522153
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108522153
  09163 Immune disease
   05310 Asthma
    108522153
   05322 Systemic lupus erythematosus
    108522153
   05323 Rheumatoid arthritis
    108522153
   05320 Autoimmune thyroid disease
    108522153
   05330 Allograft rejection
    108522153
   05340 Primary immunodeficiency
    108522153
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108522153
   05416 Viral myocarditis
    108522153
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108522153
   05150 Staphylococcus aureus infection
    108522153
   05152 Tuberculosis
    108522153
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108522153
   05169 Epstein-Barr virus infection
    108522153
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108522153
   05140 Leishmaniasis
    108522153
   05143 African trypanosomiasis
    108522153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108522153
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108522153
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Inhibitor_I68
Other DBs
NCBI-GeneID: 108522153
NCBI-ProteinID: XP_017717701
UniProt: A0A2K6LXP2
LinkDB
Position
Un
AA seq 198 aa
MDLLCKNMKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWW
SWIRQPPGKGLEWIGRISGSGGSTYYNPSLKNRVTISIDTSKNQFSLKLSSVTAADTAVY
YCARDTVRGGECEPRHKPPCREAEGAGAGAAQDQQGARGAHRAGGRVRSRCREGGASSSA
QCSPSSPAPQLSPGLLFL
NT seq 597 nt   +upstreamnt  +downstreamnt
atggacctcctgtgcaagaacatgaagcacctgtggttcttcctcctcctggtggcagct
cccagatgggtcctgtcccaggtgcagctgcaggagtcgggcccaggactggtgaagcct
tcggagaccttgtccctcacctgcgctgtctctggtggctccatcagcagttactggtgg
agctggatccgccagcccccagggaaggggctggagtggattgggcgtatctctggtagt
ggtgggagcacctactacaacccgtccctcaagaatcgagtcaccatttcaatagacacg
tccaagaaccagttctccctgaagctgagctctgtgaccgccgcggacacggccgtgtat
tactgtgcgagagacacagtgaggggaggtgagtgtgagcccagacacaaacctccctgc
agggaggcggagggggcgggcgcaggtgccgctcaggaccagcagggggcgcgcggggcc
cacagagcaggaggccgggtcaggagcaggtgcagggagggcggggcttcctcatctgct
cagtgctctccctcctcaccagcacctcagctgtccccagggctcctctttctttga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108524775
Entry
108524775         CDS       T04641                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04020  Calcium signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04145  Phagosome
rbb04151  PI3K-Akt signaling pathway
rbb04613  Neutrophil extracellular trap formation
rbb04640  Hematopoietic cell lineage
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04672  Intestinal immune network for IgA production
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05143  African trypanosomiasis
rbb05146  Amoebiasis
rbb05150  Staphylococcus aureus infection
rbb05152  Tuberculosis
rbb05169  Epstein-Barr virus infection
rbb05171  Coronavirus disease - COVID-19
rbb05202  Transcriptional misregulation in cancer
rbb05310  Asthma
rbb05320  Autoimmune thyroid disease
rbb05322  Systemic lupus erythematosus
rbb05323  Rheumatoid arthritis
rbb05330  Allograft rejection
rbb05340  Primary immunodeficiency
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108524775
   04020 Calcium signaling pathway
    108524775
   04072 Phospholipase D signaling pathway
    108524775
   04151 PI3K-Akt signaling pathway
    108524775
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108524775
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108524775
   04613 Neutrophil extracellular trap formation
    108524775
   04650 Natural killer cell mediated cytotoxicity
    108524775
   04662 B cell receptor signaling pathway
    108524775
   04664 Fc epsilon RI signaling pathway
    108524775
   04666 Fc gamma R-mediated phagocytosis
    108524775
   04672 Intestinal immune network for IgA production
    108524775
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108524775
  09163 Immune disease
   05310 Asthma
    108524775
   05322 Systemic lupus erythematosus
    108524775
   05323 Rheumatoid arthritis
    108524775
   05320 Autoimmune thyroid disease
    108524775
   05330 Allograft rejection
    108524775
   05340 Primary immunodeficiency
    108524775
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108524775
   05416 Viral myocarditis
    108524775
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108524775
   05150 Staphylococcus aureus infection
    108524775
   05152 Tuberculosis
    108524775
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108524775
   05169 Epstein-Barr virus infection
    108524775
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108524775
   05140 Leishmaniasis
    108524775
   05143 African trypanosomiasis
    108524775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108524775
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    108524775
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 108524775
NCBI-ProteinID: XP_017721332
LinkDB
Position
Un
AA seq 142 aa
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSTYGWSWIRQP
PGKGLEWIGYIYGSGGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCARDT
VRGGECEPRHKPPCREAEGRAQ
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtagcagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcaggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctccattagcagtacttatggctggagctggatccgccagccc
ccagggaagggactggagtggattgggtatatctatggtagtggtgggagcacctactac
aacccgtccctcaagagtcgagtcaccatttcaacagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcagacacggccgtgtattactgtgcgagagacaca
gtgaggggaggtgaatgtgagcccagacacaaacctccctgcagggaggcggaggggcgg
gcgcag

DBGET integrated database retrieval system