KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512065
Entry
108512065         CDS       T04641                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha 4
  KO
K06241  laminin, alpha 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05143  African trypanosomiasis
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108512065 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108512065 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108512065 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108512065 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108512065 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108512065 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108512065 (LAMA4)
   05145 Toxoplasmosis
    108512065 (LAMA4)
   05143 African trypanosomiasis
    108512065 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_EGF Laminin_G_3
Other DBs
NCBI-GeneID: 108512065
NCBI-ProteinID: XP_017702596
LinkDB
Position
Un
AA seq 1823 aa
MALSSAWRWVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFRTLSGECVPCDCNGNSNECLDGSGFCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGLEPPTGTDCSTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTIKHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRRRQPFFTQRELVDEEADEAHELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNHVRDAEDMNRATAARQRDHEKQQERVREQMEVVNTSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKNELQVKLSNLSNLSHDLVQEAIDHAQELQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIINYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTMMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVDS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHPRTSMDDLKAFTSLSLYMKPPVKQPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYIYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPHSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITKRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSSGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAAPEILQSRTLRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVVMDVKGIKVQSVDKQYNDGLSHFVITSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQAGEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKRKNLSKPKASQNKKGGKSKDAPSWD
PVALKFPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGALVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
NT seq 5472 nt   +upstreamnt  +downstreamnt
atggctttgagctcagcctggcgctgggtcctgcctctgtggctcctctggagcgctgcc
tgctcccgcgccgcgtccggggacgacaacgcttttccttttgacattgaagggagctca
gcggttggcaggcaagacccgcctgagacgagcgagccccgcgtggctctgggacgcctt
ccgcctgcggccgagaaatgcaatgctggattttttcgcaccctgtcgggggaatgtgtg
ccctgcgactgtaatggcaattccaacgagtgtttggacggctcaggattctgtgtgcac
tgccagcggaacacaacaggagagcactgtgaaaaatgtctggatggttatatcggagat
tccatcaggggagcaccccgattctgccagccatgcccctgtcccctaccccacttggcc
aattttgcagaatcttgctataggaaaaatggagctgttcggtgcatttgtaaagaaaat
tatgctggacctaactgtgaaagatgtgctcctggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcagatcccaacctgatctttgaa
gattgtgatgaagtcactggccagtgtaggaactgcttacgcaacaccaccggattcaag
tgtgaacgctgcgctcctggctactatggggacgccaggatagccaagaactgtgcagtg
tgcaactgtgggggaggcccatgtgacagtgtaaccggagaatgcttggaagaaggtttg
gaaccccctacaggcacggactgctcaaccataagctgtgataagtgtgtctgggacctg
actgatgacctgcggttagcagcactctccattgaggaaggcaaatccggggtgctgagc
gtatcctctggggccgccgctcataggcacgtgaatgaaatcaacgccaccatctacctc
ctcaaaacaaaattgtcagaaagagaaaaccaatacgccctaagaaagatacaaatcaac
aatgctgagaacacgatgaaaagccttctgtctgacgtagaggaattagttgaaaaggaa
aatcaagcctccagaaaagggcaacttgttcagaaggaaagcatggacaccattaaacac
gcaagtcagcttgtagagcaagcccatgatatgagggataaaatccaagagatcaacaac
aagatgctctattatggggaagagcatgaacttagccccaaggaaatctctgagaagctg
gtgttggcccagaagatgcttgaggagattagacgccgtcaaccattttttacccaacgg
gagcttgtggatgaggaggcagatgaggctcacgaactgctgagccaggctgagagctgg
cagcggctgcacaatgagacccgcactctgtttcctgtcgtcctggagcagctggacgac
tacaatgctaagttgtcagatctccaggaagcacttgaccaggcccttaaccacgtcagg
gatgctgaagacatgaacagggccacagcagccaggcagcgggaccacgagaaacaacag
gaaagagtgagggaacaaatggaagtggtgaacacgtctctgagcacatctgcggactct
ctgacaacacctcgcctaactctttcagaacttgatgatataataaagaatgcatcaggg
atttatgcagaaatagatggagccaaaaatgaactacaagtaaaactatctaacctaagt
aacctcagccatgatttagtccaagaagctattgaccatgcacaggaacttcaacaagaa
gctaatgaactgagcaggaagttacacagttcagatatgaacgggctggtacagaaggct
ttggatgcatcaaatgtctatgaaaatatcattaattatgttagtgaagccaatgaaaca
gcagaatttgctttgaacaccactgaccgaatttatgatgcggtgagtgggattgatact
caaatcatttaccataaagatgaaagtgagaacctcctcaatcaagccagagaactgcaa
gcaaaggcagagtctagcagtgatgaggcagtggctgacactagcaggcgtgtgggtgga
gccctagcaaggaaaagtgcccttaaaaccagactcagtgatgccgttaagcaactacaa
gcagcagagagaggggatgcccagcagcgcctggggcagtccaggctgatcaccgaggaa
gccaacaggacgatgatggaggtgcagcaggccaccgcccccatggccaacaatctaacc
aactggtcacagaatcttcaacattttgactcttctgcttacaacactgcagtggactct
gctagggatgcagtaagaaatctgacagaggttgtccctcagctcctggatcagcttcgt
acagttgagcagaagcggcctgcaagcaacgtttctgccagcatccagaggatccgagag
ctcattgctcagaccagaagtgttgccagcaagatccaagtctccatgatgtttgatggc
cagtcagctgtggaagtgcacccgagaaccagtatggatgacttaaaggcttttacgtct
ctgagcctgtacatgaaaccccctgtgaagcagccagaactgaccgagactgcagatcag
tttatcctgtaccttggaagcaaaaatgccaaaaaagagtatatgggtcttgcaataaaa
aatgataacctggtatacatctataatttgggaaccaaagacgtggagattcccctggac
tccaagcccgtcagttcctggcctgcttacttcagcattgtcaagattgaaagggtggga
aaacatggaaaggtgtttttaacagtcccgagtctaagtagcacagcagaggaaaagttc
attaaaaagggggaattttcaggagatgactccctgctggacctggaccccgaggacacg
gtgttttatgttggtggagtgccttccaacttcaagctccctcacagcttaaacctgcct
ggcttcgttggctgcctggaactggccactttgaataatgatgtgatcagcttgtacaac
tttaagcacatctataatatggacccctccacatcagtgccctgtgcccgagataagctg
gccttcactcagagccgggctgctagttacttcttcgatggctctggttatgccgtggtg
agagacatcacaaagagagggaaatttggtcaggtgactcgctttgacatagaagttcga
acaccagctgacaacggccttattctcctgatggtcaatggaagtatgtttttcagactg
gaaatgcgcaatggttacctacacgtgttctatgattttggattcagcagtggccctgtg
catcttgaagatacgttaaagaaagctcaaattaatgatgcaaaataccatgagatctca
atcatttaccacaatgataagaaaatgatcttggtagttgacagaaggcatgtcaagagc
atggataatgaaaagatgaaaataccttttacagatatatacattggaggagctgcccca
gaaatcttacaatccaggacccttagagcacaccttcccctagatatcaacttcagagga
tgcatgaagggcttccagttccaaaagaaagatttcaatttactggagcagacagaaacc
ctgggagttggttatggatgcccagaagactctcttatatctcgcagagcatatttcaat
ggacagagcttcattgcttcaattcagaaaatatctttctttgatggctttgaaggaggt
tttaatttccgaacattacaaccaaatgggttactattctattatgcttcagggtcagat
gtgttctccatctcactggataatggtactgtcgtcatggatgtaaagggaatcaaagtt
cagtcagtagataagcagtacaatgatgggctgtcccacttcgtcattacctctgtctca
cccacaagatatgaactgatagtagataaaagcagagttgggagtaagaatcctaccaaa
gggaaaatagaacagacacaagcaggtgaaaagaagttttacttcggtggctcaccaatc
agtgctcagtatgctaatttcactggctgcataagtaatgcctactttaccagggtggat
agagatgtggaggttgaagatttccaacggtatactgaaaaggtccacacttctctttat
gagtgtcccattgagtcttcaccattgtttctcctccataaaaaacgaaaaaatttatcc
aagcctaaagcaagtcagaataaaaagggagggaaaagtaaagatgcaccttcatgggat
cctgttgccctgaaattcccagagcggaatactccaagaaactctcattgccacctttcc
aacagccctagagcaatagagcacgcctatcaatatggaggaacagccaacagccgccaa
gagtttgaacacttaaaaggagattttggtgcaaaatctcagttttccattcgtctgaga
actcgttcctcccatggcatgatcttctatgtctcagaccaagaagagaatgactttatg
actctatttttggcccacggccgcttggtttacatgtttaatgttggtcacaagaaactg
aagattagaagccaggagaaatacaatgatggcctgtggcatgatgtgatatttattcga
gaaaggagcagtggccgactggtaattgatggtcttcgagtcttagaagaaagtcttcct
cctactgaagctacctggaaaatcaagggtcccatttatttgggaggtgtggctcctgga
aaggctgtgaaaaatgttcagattaactccatctacagttttagtggctgtctcagcaat
cttcagctcaatggggcctccatcacctctgcttctcagacattcagtgtgaccccttgc
tttgaaggccccatggaaacaggaacttacttttcaacagaaggaggatacgtggttcta
gatgaatctttcaatattggattgaagtttgaaattgcatttgaagtccgtcccagaagc
agttccggagccctggtccacggccatagtgtcaatggggagtacctaaatgttcacatg
aaaaatggacaggtcatcgtgaaagtcaataatggcatcagagatttttccacctcagta
acacccaagcagagtctctgtgatggcagatggcacagaattacagttattagagattct
aatgtggttcagttggatgtggactctgaagtgaaccacgtggttggacccctgaatcca
aaaccaattgatcacagggagcctgtgtttgttggaggtgttccagaatctctactgaca
ccacgcttggcccccagcaaacccttcacaggctgcatacgccactttgtgattgacgga
cacccagtgagcttcagtaaagcagccctggtcagcggcgccgtgagcatcaactcctgt
ccagcagcctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512695
Entry
108512695         CDS       T04641                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05020  Prion disease
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108512695 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108512695 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108512695 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108512695 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108512695 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    108512695 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108512695 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108512695 (LAMC1)
   05145 Toxoplasmosis
    108512695 (LAMC1)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 108512695
NCBI-ProteinID: XP_017703538
LinkDB
Position
Un
AA seq 1595 aa
MRGSQRAAPALRRRRRLWPVLVVLAAACAQAAMDECTDEGGRPQRCMPEFVNAAFNVTVV
ATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTML
AGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCEN
TYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWV
TATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFDKLV
CNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCSGRSQECYFDPELYRSTGHG
GHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMG
DKCDRCQPGFHSLTEAGCRCNVMLEQEDVLPAQCRRSIVKGSAFFLRLHCVFSVTIGFAH
PASVWAFFCPSNAVLQVVYSISSTFQIDEDGWRVEQRDGSEASLEWSSERQDIAVISDSY
FPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNS
YPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLA
SARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCSGHSETCD
PETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCTN
CPTGTTGKRCELCDDGYFGDPLGGNGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIY
NTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTVKQQSSCNPVTGQCECLPHVTGR
DCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFG
FGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPAC
YRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKD
VDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENTERLIEIASRELEK
AKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANDTSTEAYNL
LLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQL
SPLDSETLENEANNIKMEAENLERLIDQKLKDYEDLREDMRGKELEVKNLLEKGKTEQQT
ADQLLARADAAKALAEEAAKKGRDTLQEANDILSNLKDFDRRVNDNKTAAEEALRKIPAI
NQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEV
TDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLL
SIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMD
YNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4788 nt   +upstreamnt  +downstreamnt
atgagggggagccagcgggccgcgccggccctgcggcgccggaggcggctctggcccgtg
ttggtcgtgctggccgccgcctgtgcccaggcagccatggacgagtgcacggacgagggc
gggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtgaccgtggtg
gctaccaacacgtgtgggactccgcccgaggagtactgtgtgcagaccggggtgaccggg
gtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcacggggcagcc
ttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagaccatgctg
gctggggtgcagtaccccagctccatcaacctcacgctgcacctgggaaaagcttttgac
atcacctacgtgcgtctcaagttccacaccagccgcccagagagctttgccatttacaag
cgcacgcgggaagatgggccctggatcccttaccagtactacagtggttcctgcgagaac
acctactccaaggcaaaccgcggcttcatcaggacaggaggggacgagcagcaggccttg
tgtactgatgaattcagtgacatttctcccctcactgggggcaacgtggccttttctacc
ctggaaggaaggccaagtgcctataactttgacaatagccctgtgctgcaggaatgggta
actgccactgacatcagagtaactcttaatcgcctgaacacttttggagatgaagtgttt
aacgatcccaaagttctcaagtcctattattatgcgatctctgattttgctgtgggtggc
agatgtaaatgtaatggacacgcaagcgagtgtatgaagaacgaatttgataagctggtg
tgtaactgcaaacataacacatatggagtagactgtgaaaagtgtcttcctttcttcaat
gaccggccatggaggagggcaactgcggaaagtgccagtgaatgcctgccctgtgactgc
agtggtcgatcccaggaatgctacttcgaccctgaactctatcgttctactggccatggg
ggtcactgtaccaactgccaggataacacagatggcgcccactgtgagaggtgccgggag
aacttcttccgccttggaaacaatgaagcctgctctccatgccactgtagtcctgtgggc
tctctaagcacacagtgtgatagttacggcagatgcagctgtaagccaggagtaatgggg
gacaaatgtgaccgttgccagcctggattccattctctcactgaggcaggatgcagatgt
aatgtaatgttggaacaggaagatgttttgccagcacaatgtcgaaggtcaattgtgaaa
ggtagtgcattctttctccggctgcattgtgttttctctgttaccatagggtttgcacac
cctgcttctgtttgggcattcttctgtccgtcaaatgctgtgctacaagtggtttattct
atctcctctacctttcagattgatgaggatgggtggcgtgtggaacagagagatggctct
gaagcatctctcgaatggtcctctgagaggcaagatattgccgtgatctcagacagctac
tttcctaggtacttcattgctcctgcaaagttcttgggcaagcaggtgttgagttatggt
cagaacctctccttctcctttcgagtggacaggcgagatactcgcctctctgcagaagac
cttgtgcttgagggagctggcttaagggtatctgtgcccttgatcgctcagggcaattcc
tatccaagtgagaccactgtgaagtatgtcttcaggctccatgaagcaacagattaccct
tggaggcctgctcttaccccttttgaatttcagaagctcctaaacaacttgacctctatc
aaaatccgtgggacatacagtgagagaagtgctggatatttggatgatgtcaccctggca
agtgctcgtcctgggcctggagtccctgcaacttgggtggagtcctgcacctgtcctgtg
ggatatggagggcagttttgtgagatgtgcctttcaggttacagaagagaaactcctagt
cttggaccatacagtccatgtgtgctttgcacctgcagtggacacagcgagacctgtgat
cctgagacaggtgtttgtaactgcagagacaatacggctggcccgcactgtgagaagtgc
agtgatgggtactatggggattcaactgcgggaacctcctctgattgccagccctgtccg
tgtcccggaggctcaagttgtgctgttgtccccaagacaaaagaggtggtgtgcaccaac
tgtcctactggcaccactggtaagagatgtgagctctgtgatgatggctactttggagac
cccctgggtggaaacggccctgtgagactttgccgcctgtgccagtgcaatgacaacatc
gatcccaacgcagttgggaattgcaatcgtttgacaggagaatgcctgaagtgcatctat
aatactgctggcttctattgtgaccggtgcaaagacggattttttggaaatcccctggct
cccaatccagcagacaaatgcaaagcctgcaattgcaatccgtatgggacagtgaagcag
cagagcagctgtaaccccgtgacggggcaatgtgaatgtttgcctcacgtgactggccgg
gactgtggtgcttgcgaccctggattctacaacctgcagagtgggcaaggctgtgagagg
tgtgactgccatgccttgggctccaccaatgggcagtgtgacatccgcaccggccagtgt
gagtgccagcctggcatcaccggtcagcactgtgagcgctgtgaggtcaaccactttggg
tttggacctgaaggctgcaaaccctgtgactgtcatcccgaggggtctctttcacttcag
tgcaaagacgatggtcgctgtgaatgcagagaaggctttgtgggaaatcgctgtgatcag
tgtgaagaaaactatttctacaatcggtcttggcctggctgccaggaatgtccagcttgt
taccgtttggtaaaggataaggttgctgatcatcgagtgaagctccaggaattagagagt
ctcatagcaaaccttggaactggggatgagatggtgacggatcaagccttcgaggataga
ctaaaggaagcagagagggaagttatggacctccttcgtgaggcccaggatgtcaaagat
gttgaccagaatttgatggatcgcctacagagagtgaataacactctgtccagccaaatt
agccgtttacaaaatatccggaataccattgaagagactggaaacttggctgaacaagca
cgtgcccatgtagagaacacagagaggttgattgaaatcgcgtccagagaacttgagaaa
gcaaaagtcgctgctgccaatgtgtcagtcactcagccagaatctacaggggacccaaac
aacatgactcttttggcagaagaggctcgaaagcttgctgaacgtcataaacaggaagct
gatgacattgttcgagtggcaaagacagccaatgatacatcaactgaggcatacaacctg
cttttgaggacattggcaggagaaaatcaaacagcatttgagattgaagagcttaatagg
aagtatgaacaagcgaagaacatctcacaggatctggaaaaacaagctgcccgagtacat
gaggaggccaaaagggccggtgacaaagctgtggagatctatgccagcgtggctcagctg
agccctttggactctgagacactggagaatgaagcaaataacataaagatggaagctgag
aatctggaacgtctgattgaccagaaattgaaagattatgaggacctcagagaagacatg
agagggaaggaacttgaagtcaagaaccttctggagaaaggaaaaactgaacagcagacc
gcagaccaactcctagcccgagctgatgctgccaaggccctcgccgaagaagctgcaaag
aagggacgtgataccttacaagaagctaatgacattctcagcaacctgaaagattttgat
aggcgtgtgaacgataacaagacagccgcagaggaggcactaaggaagattcctgccatc
aaccagaccatcattgaagccaatgaaaagaccagggaagcccagcaggccctgggcaac
gctgcggcggacgccacagaggccaagaacaaggcccatgaggcagagaggatcgcgagc
gctgtccaaaagaatgccaccagcaccaaggcagaagctgaaagaacttttgcagaagtt
acagatctggataatgaggtgaacaatatgttgaagcaactacaggaagcagaaaaagag
ctaaagagaaaacaagatgatgctgaccaggacatgatgatggcagggatggcttcacag
gctgctcaagaagccgagatcaatgccagaaaagccaagaactctgttactagcctcctc
agcattattaatgacctcttggaacagctggggcagcttgacacagtggacctgaataag
ctaaacgagattgaaggcaccctaaacaaagccaaagatgaaatgaaggtcagcgatctt
gataggaaagtgtctgacctggagaatgaagccaagaagcaggaggctgccatcatggac
tataatcgagatatcgaggagatcatgaaggacattcgcaatctggaagacatcaggaag
accttaccatctggctgcttcaacaccccgtccattgaaaagccctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512736
Entry
108512736         CDS       T04641                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma 2
  KO
K06246  laminin, gamma 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108512736 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108512736 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108512736 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108512736 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108512736 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108512736 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108512736 (LAMC2)
   05145 Toxoplasmosis
    108512736 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 108512736
NCBI-ProteinID: XP_017703599
UniProt: A0A2K6LDW5
LinkDB
Position
Un
AA seq 1193 aa
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDQEIYRQTGNGFRCLNCNDNT
DGIHCERCKDGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCQSGYYNLDRGN
PEGCTQCFCYGHSASCRSSADYSVHKITSTFNQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSARRPDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTLRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSAKLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPAEKCRACNCNPMGSEPVECRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGAVLDTELEGRMQQAEQAL
RDILRDAQISEGASRSLGLQLAKVRSQENSYRSRLDDLKMTVERVRALGSQYQNQVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTK
ETEDYSKQALSLVHKALHEGGGSGSGNRDGAVVQGVVEKLEKTKSLAQQLTREATQAETE
ADRSYQHSLRLLDSVSQLQGVNDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRAQKNLG
DWEEETQQLLQNGKNGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTRQAERALGSAAADAQRAKNGAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKTEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNTGVTIQDTLNTLDGLLHLMDQPVSVDEEGLILLEQKLSRAKNQINSQLRP
MMSELEERARRQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTPVLEQQ
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctgggctgctgcctctgcttctcgctcctcctgcccgcagcccgg
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcagtgtatctttgat
caggaaatttacagacaaactggtaatggattccgctgcctcaactgcaatgacaacact
gatggcattcactgcgagaggtgcaaggacggcttttaccggcacagagaaagggaccgc
tgtttgccctgcaattgtaactccaaaggttctcttagtgctcgatgtgacaactccgga
cggtgcagctgtaaaccgggtgtgacaggagccagatgcgaccgatgtctgccaggcttc
cacatgctcacggatgcggggtgcacccaagaccagagactgctagactccaagtgtgac
tgtgacccagctggcatcgcagggccctgtgacgcgggccgctgtgtctgcaagccagct
gtcactggagaacgctgtgataggtgtcaatcaggttactataatctggatcgggggaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccgcagctctgca
gactacagtgtccataagatcacctctacctttaatcaagatgttgatggctggaaggct
gtccaacgaaatgggtctcctgcaaagctccaatggtcgcagcgccatcaagatgtgttt
agctcagcccgacgaccagaccctgtctattttgtggctcctgccaaatttcttgggaat
caacaggtgagctatgggcaaagcctgtcctttgactaccgtgtggacagaggaggcaga
cacccatctgcccacgatgtgatcctggaaggtgctggtctacggatcacagctcccttg
atgccacttggcaagacactgccttgtgggctcaccaagacttacacactcaggttaaat
gagcatccaagcagtaattggagcccccagctgagttactttgagtatcgaaggttactg
cggaatctcacagccctccgcatccgagctacatatggagaatacagtactgggtacatt
gacaatgtgaccctgatttcagcccgacccgtctctggagccccggcaccctgggttgaa
cagtgtatatgtcctgttgggtacaaggggcaattctgccaggattgtgcttctggctac
aagagagattcagcgaaactggggccttttggcacctgtattccttgtaactgtcaaggg
ggaggggcctgtgatccagacacaggagattgttactcaggggatgagaatcctgacatt
gagtgtgctgactgcccaattggtttctacaatgatccacacgacccccgcagctgcaag
ccatgtccctgtcataacgggttcagctgctcagtgatgccagagacagaggaggtggtg
tgcaataactgccctcccggggtcaccggtgcccgctgtgagctctgtgctgatggctac
tttggggacccctttggtgaacatggcccagtgaggccttgtcagccctgtcaatgcaac
aacaatgtggaccccagtgcctctgggaactgtgaccggctgacaggcaggtgtctgaag
tgtatccacaacacagccggcatctactgcgaccagtgcaaagcaggctacttcggggac
ccgttggctcccaatccagcagaaaagtgtcgagcttgcaactgcaaccccatgggctca
gagcctgtagaatgtcgaagtgatggcacctgtgtttgtaagccaggatttggtggcccc
aactgtgagcatggagcattcagctgtccagcttgctataatcaagtgaagattcagatg
gatcagtttatgcagcagcttcagagaatggaggccctgatttcaaaggctcagggtggt
gatggagcagtacttgatacagagctggaaggcaggatgcagcaggctgagcaggccctt
cgggacattctgagagatgcccagatttcagaaggtgctagcagatcccttggtctccag
ttggccaaggtgaggagccaagagaacagctaccggagccgcctggatgacctcaagatg
actgtggaaagagttcgggccctgggaagtcagtaccagaaccaagttcgggatactcac
aggctcatcactcagatgcaactgagcctggcagaaagtgaagcttccttgggaaacact
aacattcctgcctcagaccactacgtggggccaaatggctttaaaagtctggctcaggag
gccacgagattagcagaaagccacgttgagtcggccagtaacatggagcaactgacaaaa
gaaactgaggactattccaaacaagccctctcactggtgcacaaggccctccatgaagga
ggcggaagcggaagcggtaaccgggacggtgctgtggtgcagggggttgtggaaaaattg
gagaaaaccaagtccctggcccagcagttgacaagggaggccactcaagcggaaactgaa
gcagataggtcttatcagcacagtctccgcctcctggattcagtgtctcagcttcaggga
gtcaatgatcagtcctttcaggtggaagaagcaaagaggatcaaacaaaaagctgattca
ctctcaagcctggtgaccaggcatatggatgagttcaaacgtgcacaaaagaatctggga
gactgggaagaagaaacacagcagctcttacagaatggaaagaatgggagagagaaatca
gatcagctgctttcccgtgccaatcttgctaaaagcagagcacaagaagcactaagtatg
ggcaatgccactttttatgaagttgagagcatccttaaaaacctcagagagtttgacctg
caggtggacaacagaaaagcagaagctgaagaagccatgaagagactctcctacatcagc
cagaaggtttcagacgccagtgacaagacccggcaagcagaaagagccctggggagtgct
gctgctgacgcacagagggcaaagaatggggccagggaggccctggagatctccagtgag
attgaacaggagattgggagtctgaacttggaagccaatgtgacagcagatggagccttg
gccatggaaaagggactggcctctcttaagactgagatgagggaagtggaaggagagctg
gaaaggaaggagctggagtttgacacgaatatggatgcagtacagatggtgattacagaa
gcccagaaggttgacaccagagccaagaacactggggttacaatccaagacacactcaac
acattggatggcctcctgcatctgatggaccagcctgtcagtgtagatgaagaggggctg
atcttattggagcagaagctttcccgagccaagaaccagatcaacagccaactgcggccc
atgatgtcagagctggaagagagggcacgtcggcagaggggccacctccatttgctggag
acaagcatagatgggattctggctgatgtgaagaacttagagaacattagggacaaccta
cccccaggctgctacaataccccggttcttgagcaacagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513926
Entry
108513926         CDS       T04641                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma 3
  KO
K06247  laminin, gamma 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108513926 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108513926 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108513926 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108513926 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108513926 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108513926 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108513926 (LAMC3)
   05145 Toxoplasmosis
    108513926 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 108513926
NCBI-ProteinID: XP_017705382
LinkDB
Position
Un
AA seq 1601 aa
SAAAALLLGLALLAPRAAGAGMGAWYDGAGRPQRCCPCFENAAFGRLAQASHTCGSPPED
FCXHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHNQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRTNGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDTAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPVGCSSC
FCYGHSKVCTATAQFQVHHILTDFHQGAEGWWARSVGGPEHPPQWSPHGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFQVPPRGSPLPVQLRLEGAGLALSLRHSSLSGPQDVGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLTNLTSLRLHVSPGPSPAGQVFLTEVRLTSAR
PGLSPPASWVETCSCPNGYMGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVACTHCPPG
QRGRRCEVCDDGFFGDPLGLSGLPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTAG
DHCERCREGFYGSALAPRPADKCKPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTGRDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCRECPSCYALV
KEEAAKLKAKLTLMEGWLQGSNCGSPWGPLDILQGEAPRGDVYQGHHLLPGVREAFLEQM
MGLEGAVKASREQLQRLSKGAHCAQAGAQKTCTQLTDLEAVLESSEEEILHAAAILASLE
IPQDGPGQPTKWSHLATEARALARSHRDTATKIAATAQRALLASNTSYVLLWSLLEGRMA
LETQRDLEDRYQEVQAAQKALGTAMAELLPEAESVLATVQQVGADTAPYLALLASPGALP
QKSWAEDLGLKAKTLEKTVASQQHMATKASRTLQAAAQAALRQTEPLTQVSFKAGDLGEV
GATLKVACTSNFHSLSRGLWPARQLCQRLPGRRWRCEPSSPDPASAGFAGMKLQFPRPKD
QAALQRKADSVRDRLLADMRKKTKQAERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKA
LLREGNQAHHRASRLTSQTQATLQQASRQVLDSEARQQELEEAEQVGAGLSEMEQQIRES
RISLEKDIEALSELLARLGSLDTHQAPAQALNETQRALERLRLQLASPGALQRKLRLLEQ
ESELQELQIQGFESDLAEIRADKRNLEAILHSLPENCASWQ
NT seq 4806 nt   +upstreamnt  +downstreamnt
tcggcggcggctgcgctcctgctggggttggcgctgctggcacctcgggcggccggcgcg
ggcatgggagcgtggtacgacggcgcggggcgcccgcagcgctgctgcccgtgtttcgag
aacgcggcgttcggccggcttgcccaggcctcgcacacgtgcggcagcccgccggaggac
ttctgcncccacgtgggcgccgcgggcgcgggggcgcagtgccagcgctgcgacgcagcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacaaccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgcctggggaaggcttacgagatcacgtatgtgaggctaaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcaccaatggcccgtgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cctggcgaggatgagcgcgtggccttctgcacctccgagttcagcgacatctccccgctg
agtgggggcaatgtggccttctccaccctggagggccggcccagcgcctacaacttcgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggaccccaaggtgctccagtcctactactat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgt
ggccccgacacggcgggccagttggcctgccggtgccagcacaacaccaccggcacggac
tgtgagcgctgcttgcccttcttccaggaccgtccgtgggcccggggcaccgctgaggcc
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgttcgatcgg
gagctcttccgcagcacaggccacggcggccgctgtcaccactgccgtgaccacacagcc
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccacggatgccatgc
cagccctgtgactgccattcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgatcgctgtctgcccgggttccac
tcgctcagcgagggaggctgcagaccctgcacctgcaatcctgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacttatgtgac
agatgtcgccctgggacttttaacctgcagccccacaatccggtcggctgcagcagctgt
ttctgctatggccactccaaggtgtgcacggccactgcccagttccaagtgcatcacatc
ctcaccgatttccaccagggagccgaaggctggtgggccagaagtgtggggggccccgag
caccccccacaatggagcccacatggggtactcctgagcccagaagacgaggaggagctc
acagcaccagagaagttcctgggagaccagcggttcagctatgggcagcccctcatcctg
accttccaggtgccccccaggggctccccactccctgtgcagctgaggctggaaggggcg
ggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgtcgggcatccc
agggaggtagagctcaggttccacctgcaggagacctctgaggatgtggcccctccgctg
cccccgttccacttccagcggctcctcaccaacctgaccagcctccgcctccatgtcagt
cccggtcccagccctgctggccaagtgttcctgactgaggtccggctcacatctgcccgg
ccagggctttccccgccagcttcctgggtggagacttgttcatgtcccaatggctacatg
ggccagttctgcgaatcctgtgctccgggatacaagagggagatgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgcgtctgcagccaccataccgagggcccatcctgtgaacgctgcttgccgggtttc
tatggcaaccccttcgcgggccaagccgacgactgccagccatgtccctgccctggccag
tcggcctgcacgaccatcccagagagcggggaggtggcgtgcacccactgccccccgggt
cagagagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctggggctc
tcggggctcccccagccctgccaccagtgccagtgcagcgggaatgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccgcgggt
gaccactgtgagcgctgtcgtgaaggtttctatgggagcgccctggcccctcggcccgca
gacaaatgcaagccctgcagctgccacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccagtgctcctgcctgcctcacgtgactggacgggactgtagccgc
tgctaccctggcttcttcgacctccagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacagatgccagctgggtttcttcggcttctccatcaag
ggctgccgggcctgcaggtgctccccactgggcgctgcctcagcccagtgccacgagaac
ggtacatgcgtatgcaggcctggctttgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagatggcacacactgccgggaatgcccgtcctgctatgccctggtg
aaggaggaggcagccaaactgaaggccaaactgactttgatggaggggtggctgcaaggg
tccaactgtggcagtccctggggaccactagacattctgcagggagaggccccaaggggg
gacgtctaccagggccaccacctgcttccaggagttcgggaagccttcctggaacagatg
atgggcctcgaaggtgctgtgaaggcctcccgggagcagctgcagaggctgagcaagggt
gcccactgtgcccaggccggagcccagaagacctgcacccagctgacagacctggaggca
gtgctggagtcctcggaagaggagatcctgcatgcagctgccattctcgcgtctctggag
attcctcaggatggtcctggccagcccaccaaatggagccacctggccacagaggcccgt
gccctcgccaggagccacagagacaccgccaccaagattgcagccactgctcagagggcc
ctgctcgcctccaacaccagctacgtgcttctctggagtctgctggagggaaggatggcc
ctagagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccagaaagca
ctggggacagctatggcagagttgctgcctgaagcggaaagcgtcttggccacagtgcag
caagttggcgcagatacagccccgtacctggctttgctggcttctccgggagctctgcct
cagaagtcctgggctgaagacctgggcctgaaggcgaagaccctggagaagacagttgca
tcacaacagcacatggccaccaaggcttcccgaaccctccaggctgctgcccaggcggca
ctacggcaaacagagcccctcacacaggtcagcttcaaagcgggggacctgggagaggtt
ggggctaccctgaaggttgcatgcacctcaaacttccactcgttgtccaggggtctgtgg
ccagccaggcagctctgccagcggctgcctgggaggcgctggaggtgtgagcccagttcc
cctgacccagcctcagcggggtttgcaggaatgaagctgcagtttcctcggcccaaggac
caggcggcactgcagaggaaggcagactccgtcagggacagactccttgcagacatgaga
aagaagaccaagcaggcggagaggatgctaggaaacgcggcccctctttcctccagtgcc
aagaagaagggcagagaagcagaggtgttggccaaggacagtgccaagcttgccaaggcc
ttgctgagggaggggaaccaggcgcaccaccgtgccagccggctcaccagccagacgcaa
gccacgctccaacaggcgtcccggcaggtgctagattctgaagcacgccaacaggagctg
gaggaagctgagcaggtgggtgctgggctgagtgagatggagcagcagatccgggaatca
cgcatctccctggagaaggacatcgaggccttgtcagagctgcttgccaggctggggtcg
ctggacacccatcaagccccagcccaggccctgaacgagactcagcgggcactagaacgc
ctgaggctgcagctggcctccccgggggccttgcagaggaaactcaggctgctggagcag
gaatccgagctgcaggagctgcagatccagggcttcgagagcgacctcgccgagatccgt
gccgacaaacggaacctggaggccattctgcacagcctgcctgagaactgtgccagctgg
cagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522717
Entry
108522717         CDS       T04641                                 

Definition
(RefSeq) collagen alpha-6(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04974  Protein digestion and absorption
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108522717
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108522717
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108522717
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108522717
  09154 Digestive system
   04974 Protein digestion and absorption
    108522717
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108522717
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108522717
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108522717
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108522717
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108522717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108522717
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108522717
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108522717
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108522717
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 108522717
NCBI-ProteinID: XP_017718588
LinkDB
Position
Un
AA seq 1530 aa
MHPGLWLLLVTLCLTEELAGAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPS
GPQGFTGSTGLSGLKGERGSPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPP
GLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPSSFKGMKGDPGLPGLDG
ITGPQGAPGSPGAVGPAGPPGLQGPPGPPGPPGPDGNMGLGFQGEKGVKGDVGLPGPAGP
PPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGSTGEKGEKGIPGLPGPRGP
MGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGEKGDIGLPGPDVFIDIDGAVISGNPGDP
GVPGLPGLKGDEGIQGLRGPSGVPGSPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAG
LPGRDGLPGPPGPPGPPSPEFETKTLHNKEPGFPGLRGEQGPKGNPGLKGIKGDSGFCAC
DGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGSPGPSGPKGK
KGEPILSTVSGMPGDRGDSGSQGFPGIIGKPGNDGVPGLPGLPGLPGDGGQGFPGEKGLP
GLPGEKGHPGPPGLPGIGLPGLPGPRGLPGDKGKDGLPGQQGPPGSKGITLPCIIPGSYG
PSGFPGTPGFPGPKGYRGLPGTPGQPGSSGNKGKPGSPGLVHLPELPGFPGPRGEKGLPG
FSGLPGKDGLPGTIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGDKGLLGDSGLPGL
KGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGPPGAPGFPGTSGHPGK
KGTRGEKGPPGSIVKKGLPGLKGLPGNPGLIGLKGSPGSPGVTGLPALSGPKGEKGSVGF
VGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGHAGTPGEKGDRGNLGPVGIPSPRRPMSN
LWLKGDKGSQGSAGSDGFPGPRGDKGEAGHPGPPGLPGASGLPGTIKGVSGNPGPPGFMG
IRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGTSGLPGLKGKEHYCFLLMCSSRAS
IFHDFIGTKGRDGPIGNIGFPGNKGEDGKVGVSGDVGLRGALGFPGIAGMRGDPGLPGSS
GHQGAIGPLGPPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKG
EKGYPGIGIRAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLD
GERGRPGPPGPPGPTGPSSSQGNTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMR
GEPGFMGTPGKVGPPGDPGFPGMKGKAGPRDHCCLATMDPTTDCLSLCYLCISGHWQMLP
DCLSPTGPSAQCWAPRRQDEYDPVPALVELPSHRGERWIKKALYNITQCHPGDIQISCGD
KQGSSGPQGAPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIP
GKDGPSGLPGPPGALGDPGLRGLQGPPGFE
NT seq 4591 nt   +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctcctggttacgttgtgcctgaccgaggaactggcagga
gcgggagagaagtcttatggaaagccgtgtgggggccaagactgcagtgggagctgtcag
tgttttcctgagaaaggagcgagagggcgacctggaccaattggaattcaaggcccatca
ggtcctcaaggattcactggctctactggtttatcgggattgaaaggagaaaggggttcc
ccaggccttctgggaccttatggaccaaaaggagataagggtcccatgggagttcctgga
tttcttggcatcaatgggattccgggccatcctggacagccaggccccagaggcccacct
ggtctggatggctgtaatggaactcaaggagctgtcggatttccaggccctgatggctat
cctgggcttctcggaccacctgggcttcctggtcagaaaggatcaaaaggtgaccctgtc
cttgctccaagtagtttcaaaggaatgaagggggatcctgggctgcctggactggatgga
atcactggcccacaaggagcacccggatctcctggagctgtaggacctgcaggaccacca
ggattacaaggtcctccagggcctcctggtcctcctggtcctgatgggaatatggggcta
ggttttcaaggagagaaaggagtcaagggggatgttggcctccctggcccagcaggacct
ccaccatctactggagagctggaattcatgggattccccaaagggaagaaaggatccaag
ggtgaaccagggcctaagggttttccaggcataagtggccctccaggcttcccgggcctt
ggatctactggagaaaagggagaaaagggaatccctggtttgccaggacctaggggtccc
atgggttcagaaggagtccaaggccctccagggcaacagggcaagaaagggaccctggga
tttcctgggcttaatggattccaaggaattgagggtgaaaagggtgacattggcctgcca
ggcccagatgttttcatcgatatagatggtgctgtgatctcaggtaatcctggagaccct
ggtgtacctggcctcccaggccttaaaggagatgaaggcatccagggcctgcgtggccca
tctggtgtccctggctcaccagcattatcaggtgtcccaggagccctagggcctcaggga
tttccagggctgaagggggaccaaggaaacccaggccgtaccacaattggagcagctggc
ctccctggcagagatggtttgccaggcccaccaggtccaccaggcccacctagtccagaa
tttgagaccaaaactctacacaacaaagagccagggttccctggtctccgaggagaacag
ggtccaaaaggaaacccaggcctcaaaggaataaaaggagactcaggtttctgtgcttgt
gacggtggtgttcccaacactggaccacccggggaaccaggcccacctggtccacggggt
ctcataggccttccaggccttaaaggagccagaggagatcgaggctctgggggtgcacag
ggcccagcaggggctccaggcttagttgggtctccgggtccttcaggacccaaaggaaag
aagggggaaccaattctcagtacagtctcaggaatgccaggggatcgcggtgattctggc
tcccagggcttccctggtataataggaaaaccaggcaacgacggagtaccaggtctacca
ggtctgccaggacttccgggtgatggtgggcagggcttcccaggtgaaaaggggttacct
ggacttcctggtgaaaaaggccatcctggtccacctggcctcccgggaattgggttacca
ggacttcctggaccccgtgggcttcctggagataaaggcaaggatggattaccgggacaa
caaggccctcctggatctaagggaatcaccctgccctgtattattccggggtcatatggt
ccatcaggatttccaggcactcccggattcccaggccctaaagggtaccgaggcctccct
gggaccccaggccagcctggatcaagtggaaataaaggaaagccagggagtccaggattg
gttcatcttcctgaattaccaggatttcctggacctcgtggggagaagggcttgcctggg
ttttctgggctccctggaaaagatggcttgcctgggacgattggtagtccaggtttacct
ggttccaagggagccactggtgatatctttggtgctgaaaatggtgctccgggggaacaa
ggcctacaaggattaacaggggacaaaggacttcttggagactctggccttccaggactc
aagggtgtgcacgggaaacctggcttgctaggccccaaaggtgagcggggcagccctgga
acaccaggacaggtgggacagccaggcaccccaggatctagtggtccgtatggcatcaag
ggcaaatctggtcccccaggagcgccaggcttcccaggcacctcagggcatcctggaaag
aaaggaacaagaggcgagaaaggccctcctggatcaatagtaaagaaagggctgccaggg
ctaaaaggccttcctggaaatccaggcctaatagggctgaaaggaagcccaggctctcca
ggggtcactgggttgccagccctctctggacccaaaggagaaaaggggtctgttggattc
gtaggttttccaggaataccaggtctgcctggtatccctggaacaagaggattaaaggga
attccaggatcaactggaaaaatgggaccatctggacacgctggcactcctggtgaaaag
ggagacagaggcaatctggggccagtcggaatacctagtccaagacgtccaatgtcaaac
ctttggctcaaaggagacaaaggctctcaaggctcagccggatctgatggatttccaggg
ccaagaggtgacaaaggagaggctggtcatcctgggccaccaggcctgcctggagcttct
ggcctcccaggcactatcaaaggagttagtggaaacccaggtccccctggcttcatggga
atccggggcttacctggcctgaaggggtcctctgggataacaggtttcccaggaatgcca
ggagaaagtggttcacaaggtatcagagggtcgcctggactcccaggaacatctggtctc
ccaggcctgaaaggtaaggagcattattgttttcttttaatgtgttcttctagagcaagc
atttttcatgattttataggcacaaaaggaagagatggaccaataggcaatataggcttc
cctggaaacaaaggtgaagatggaaaagttggtgtttctggagatgttggccttcgtgga
gctctagggtttccagggattgccggcatgagaggagatccaggacttccaggctcttct
ggtcatcaaggggcaattgggcccctaggaccccccggattaataggacccaaaggcttc
cctggatttcctggtttacatggactgaatgggcttccgggaaccaagggtacccatggc
actccaggacctagtatcactggtgtgcccgggcctgctggtctccctggacccaaagga
gaaaaaggatatccaggaattggcatcagagctccagggaagccgggcctgagagggcaa
aaaggtgatcgaggtttcccaggtctccagggccccgctggtctccccggtgccccaggc
atctccttgccctcactcatagcaggacagcctggtgaccccgggcgaccaggcctagat
ggagaacgaggccgcccaggcccccctggacccccaggtcccactgggccatcctcgagt
caaggcaacaccggagaccctggcttccctggaattcctggacctaaagggcctaaggga
gaccaaggaattccaggtttttctggccttcctggagagctaggactgaaaggcatgaga
ggtgagcctggcttcatggggactccaggcaaggttgggccacctggagacccaggattt
cccgggatgaaggggaaggcagggccaagagaccactgctgccttgccaccatggatcct
actactgactgcctctctctgtgttatctctgcattagtgggcattggcaaatgcttcct
gactgcctgtcacccactgggcccagcgcccagtgttgggccccgaggagacaggatgaa
tatgacccagttcctgccctcgtggagctacccagccaccggggagagagatggataaag
aaggcattgtataatatcacacagtgccatcctggagatatccagatatcctgtggggac
aaacaaggctcttctggcccccaaggtgctcctggacaaacaccaactgcagaagctgtc
caggttcctcctggacccttgggtctaccagggatcgatggcatccctggcctcactggg
gaccctggggctcaaggccctgtaggcctacaaggctccaaaggtttacctggcattccc
ggcaaagatggtcccagtgggctcccaggcccacctggggctcttggtgatcctggtctg
cgtggactgcaaggccctccaggatttgaag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108523928
Entry
108523928         CDS       T04641                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108523928 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108523928 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108523928 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108523928 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108523928 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108523928 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108523928 (LAMA1)
   05414 Dilated cardiomyopathy
    108523928 (LAMA1)
   05416 Viral myocarditis
    108523928 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108523928 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108523928 (LAMA1)
   05145 Toxoplasmosis
    108523928 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF1080
Other DBs
NCBI-GeneID: 108523928
NCBI-ProteinID: XP_017720187
LinkDB
Position
Un
AA seq 3090 aa
MRGGGGAWGVLLASLLWVAARCQQRGLFPAILNLASNADISTNATCGEKGPEMFCKLVEH
VPGRPVRNPQCRICDGSSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQ
VFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYR
ADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLN
ADLMTLSHREPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHN
TCGESCNRCCPGYHQRPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQF
RGGGVCTNCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLH
SDLRNGKGPGQCPCKEGYAGEKCDRCQLGYKDYPACVSCGCNPVGSASDEPCTGPCVCKE
NVEGKACDRCKPGFYNLKEKNPQGCSECFCFGVSDVCSSLSWPVGQVSSMSGWLVTDLIS
PRRIPSQQDALGGRHQVSINNTAVMQTLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYGI
PVEAVDSHLVSHADVIIKGNRLTLSTQAEGVSLQPYEEYLNVIRLVPENFQDFHSKRQID
RDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASPNAIDLVVAADVEHCECPQGY
TGTSCESCLSGYYRVDGILFGGICQPCECRGHAAECDVHGVCIACVHNTTGDHCEQCLPG
FYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDQCAPGYSGAWCERCADGY
YGNPTVPGESCVPCDCNGNVDPSEAGHCDSVTGECLKCLGNTDGARCERCAEGFYGDAVT
AKNCRACGCHAKGSRSAVCHLETGLCNCKPNVTGQQCDQCLHGYYGLDSGHGCQPCNCSV
AGSVSDDCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECV
CPPHTQGVRCEECEDGHWGYDVEMGCQACNCSLVGSTHHQCDVVTGRCQCKWKFGGWACD
ECSLGYRDFPDCVPCDCDLRGTSGDACDLEQGLCGCAEETGDCPCKENVFGPQCNECREG
TFALCADNPLGCSPCFCSGLSHVCSELEGYVRTPVTLASDQPLLRVVSQSNLRGTTEGVY
YQAPDFLLDAATVWQHIHAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFE
PQVLIKGGRTRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVAREDFMSVLS
NIEYILIKASYGQGLQQSRISDISMEVGRKAENLHPEEEVASLLENCVCPPGTVGFSCQD
CAPGYHRGKLPAGSGRGPRPLVAPCVPCSCNNHSDTCDPDTGKCLNCGDNTAGDHCDVCA
SGYYGKVTGSASDCALCVCPHSPPASFSPTCVLEGDHDFRCDACLLGYEGQHCERCSLGY
YGNPQTLGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVS
CDDECVGVLLNDLDETGDAILSLNLTGIIPVPYGILSKLENTTKYLQESLLRENMQKDLG
RIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAVAIERLRMNITEIIEKT
TLNQTLDEDFLLPNSTLQSMQQNGTSLLEIMQRRDVTQLHQNATLELKAAEDLLSQIQEN
YQKPLEELEVLKEAASHLLSKHNSELKAAEVLVREAEAKTEESNHLLFMVNANLREFSDK
KLHVQEEQNLTSELIAQGRGLIDTAAAQTDAVQDALEHLEHHQDTLLLWSAKVRHHVDDL
VMHMSQRNALDLVYRAEDHAAEFQRLADVLDSGLENVRNVSLNATSAAYVHYNIQNLIEE
SEELAKDAHRTVTEMSLLSESLVSNGKAAVQRSSRFLNEGNNLSRKLPVIALELSELRNK
TNRFQENADEITRQTNESVLILRAIPEDTRDKGAKTKELATSASQSAVSTLRDVAGLSQE
LLSTSASLSRVNTTLQETHQLLQDSTMATLLAGRKVKDVETQANLLFDRLKPLKMLEENL
SRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLL
FYLGSSTSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHAARFGNIGSL
SVKEMNSNQKLPAKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEA
FLNGKSIGLWNYIEREGKCHGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNT
FSPNGLLLYLGSYGIRDFLSIELFHGRVKVTTDLGSGPLTLLTDRRYNNGTWYKIAFQRN
RKQGVLAVNDAFNTSNKETKQGETPGASSDLNRLDKDPIHVGGLPRSRVVRRGVTTKSFV
GCIKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFA
TKNSSGIILAALGGDAEKQGDREESHVPFFSIMLIGGNIEVHVNPGDGTGLRKALLHAPT
GTCSDGQAHSISLVRNRRIITVQLDENNPVEMKLGPLVESRTINMSNLYVGGIPEGEGTS
LLTTRRSFHGCIKDLIFNLGLLDFNSAVGHEQVDLDACWLSERPKPAPDAEDSELLPDPR
AFPVGAASFTISQEQCVVDAALEYVPGAHQFGLSQNSHFLLPFNQSAVRKRLSVELSIRT
FASSGLIYYMAHQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTHYG
KRKGFITVDGQESPMVTVVGDGTALDVEGLFYLGGLPSQYRARKIGNITHSIPACIGDVT
VNSKQLDKDSPVSTFTVNRCYAAAQEGTFFDGSGYAALVKEGYKVQTDVNITLEFRTSSQ
NGVLLGISTAKVDAIGLELVDGKVLFHVNNGAGRITATYEPKTATALCDGKWHTLQANKS
KHRITLIVDGNAVGAESPHTRSTSVDTNNPIYVGGYPAGVKQKCLSSQTSFRGCLRKLAL
MKRPQVQSFDFSRAFELHGVFLHSCPGTES
NT seq 9273 nt   +upstreamnt  +downstreamnt
atgcgcggcggcggcggcgcgtggggcgtgctcctggcctcgctgctgtgggtagccgcg
cggtgccagcagagaggcctgtttcctgccattctcaatcttgccagcaacgctgacatc
agtaccaatgccacctgtggcgagaaggggcccgagatgttctgcaaacttgtggagcat
gtgccgggtcggcccgtccgaaacccacagtgccggatctgtgatggcagcagtgcaaac
cccagagaacgccatccaatatcacatgccatagatggcaccaataactggtggcaaagt
cccagcattcagaatgggagagagtatcactgggtcacaatcactctggacttaaggcag
gtctttcaagttgcatatgtcatcattaaagctgccaatgcccctcggcccggaaactgg
attttggagcgttctctagatggcaccacgttcagcccctggcagtattatgcagtcagc
gactcagagtgtttgtctcgttacaatataactccaagacgagggccgcccacctacagg
gctgatgatgaagtgatctgcacctcctattattccagattggtgccacttgagcatgga
gagattcatacatcactcatcaatggcagaccaagcgctgacgatctttcacccaagttg
ttggaattcacttctgcacgatatattcgccttcgcttacaacgcattagaacgctcaat
gcagatctcatgactcttagccaccgggaacctaaagacctggatcctattgttaccaga
cgctattattattcaataaaggacatttctgttggaggcatgtgtatctgctatggccat
gctagtagctgtccatgggatgaaactacaaagaaactgcagtgtcagtgtgagcataat
acttgcggggagagctgtaacaggtgctgtcctgggtaccatcagcggccctggaggcct
ggaaccgtgtcctctggcaatacatgtgaagcatgtaattgtcacaataaagccaaagac
tgttactatgatgaaagtgttgcgaagcagaagaaaagtttgaatactgctggacagttc
agaggaggaggggtttgcacaaactgcttgcagaacaccatgggaattaactgtgagacc
tgtattgatggatattacagaccacacaaagtgtctccttatgaggatgagccttgccgc
ccctgcaactgtgaccctgtggggtccctcagttctgtctgtattaaggatgaccttcat
tctgacttacgcaatgggaaggggccgggtcagtgcccgtgtaaggaaggctatgcagga
gaaaaatgtgatcgctgccaacttggctataaggattacccggcctgtgtctcctgtggg
tgcaacccagtgggcagtgccagtgacgagccctgcacagggccctgtgtttgtaaggaa
aatgtggaggggaaagcctgcgatcgctgcaagccaggattctataacctgaaagaaaaa
aacccccagggctgctccgagtgcttctgctttggcgtttccgatgtctgcagcagcctc
tcttggcctgttggtcaggtaagcagtatgtccgggtggctggtcaccgacctgatcagt
cccaggaggattccgtctcagcaagatgcactgggcgggcgccaccaggtcagcatcaac
aacaccgcggtcatgcagacgctggctcccaagtactactgggcggcccccgaggcctac
cttggaaataagctgactgcatttggtggattcctgaaatacacagtgtcttatggcatc
ccagtagaggcggtagacagtcacctcgtgtcgcatgctgacgtcatcattaagggaaac
agactcactttaagcacacaggctgagggtgtgtcattgcagccttatgaagagtaccta
aatgtgattagacttgtgcctgaaaacttccaagattttcacagcaaaaggcagatcgat
cgtgaccagctgatgactgtccttgccaatgtgacacatcttttgatcagagccaactac
aattctgcaaaaatggctctttacaggttggagtccgtctctctggacatagccagccct
aatgccatcgacctggtggtggccgctgatgtggagcactgtgaatgtccgcaaggctac
acagggacctcctgtgagtcgtgcctctctggctattaccgcgtggatggaatactcttc
ggaggaatttgtcagccctgcgaatgccgcggccatgcagctgagtgcgatgttcacggc
gtttgcattgcatgtgtgcacaacaccaccggtgaccactgtgaacagtgcttgcctggc
ttctacggggagccttcccgagggactcccggggactgccagccctgcgcctgccctctc
accatagcctccaacaatttcagccccacctgccacctcaatgatggggatgaggtggtc
tgcgaccagtgtgccccaggatactcaggagcttggtgtgagagatgtgcagatggttac
tatggaaacccaacagtgcctggcgaatcttgtgttccctgtgactgcaacggcaatgtg
gacccctcggaggctggtcactgtgactcggtcaccggggagtgcctgaagtgcctgggg
aacacagacggcgcccgctgtgaaaggtgtgctgaaggtttctacggggacgctgtgaca
gccaagaactgccgcgcctgcggatgccatgcgaaaggctcccgttctgccgtgtgccat
cttgagaccggactctgcaactgcaaaccaaacgtgactggacagcagtgtgaccagtgt
ttgcatggctattatgggctagactcgggccatggctgccagccctgcaattgcagcgtg
gcaggctccgtgtcagatgactgcacagatgaaggccagtgtcactgcgtcccgggtgtg
gcagggaaaaggtgtgacaggtgtgcccatggcttctacgcctaccaggatggcagctgt
acaccctgtgactgcccacacactcagaatacctgcgacccagaaactggagagtgtgtc
tgcccccctcacacacagggtgtgaggtgtgaagaatgtgaggatgggcactggggctac
gatgtggagatggggtgccaggcctgcaactgcagtctcgtggggtcgactcatcatcag
tgtgacgtggtcaccggccgttgccagtgcaagtggaaatttggtggctgggcctgtgat
gagtgctccttgggttacagagactttcccgactgtgttccctgtgactgtgacctgagg
gggacgtcgggggatgcctgcgacctggagcagggtctctgcggctgtgcagaggaaacc
ggggactgcccttgcaaggagaatgtctttggccctcagtgcaacgagtgtcgagagggc
acctttgccctctgcgcggacaaccccctgggctgcagcccctgcttctgctccgggctg
tcccacgtctgctcagagctggagggctacgtgaggaccccagtaacgctggcctccgat
cagcctcttctgcgtgtggtttctcagagtaacctgaggggcacgactgagggggtttac
taccaggcccccgacttcctactggatgccgccaccgtctggcagcacatccatgcagag
ccgttttactggcggctgccgcagcagttccagggagaccagctcatggcctatggtggc
aaactgaagtacagcgtggccttctattctttggacggcgtcggcacctccaattttgag
cctcaagttctcatcaaaggtggtaggaccagaaagcaagtcatttacatggatgcacca
gccccagagaatggagtgaggcaggaacaagaagtagcaatgagagagaatttttggaaa
tattttaactctgtttcggaaaaacctgtcgcgcgagaggattttatgtctgtccttagc
aatattgagtacatcctcatcaaggcatcatatggtcaaggattacagcagagcagaatc
tcagacatttcaatggaggttggcagaaaggccgaaaacctgcacccagaagaagaggtt
gcatctcttttagagaattgtgtctgtcctcctggcactgtgggattctcgtgtcaggac
tgtgctcctgggtaccacagagggaagctcccagcagggagtggcaggggaccgcgccct
ctggttgctccttgtgtgccctgcagttgcaacaaccatagtgacacctgtgaccccgac
accgggaagtgtctgaactgcggcgataacacagcaggtgaccattgcgatgtgtgtgct
tctggctactatgggaaggtgactggctcagcaagtgactgtgctctgtgtgtctgtcct
cacagcccccctgccagttttagtcccacttgtgtcttggaaggtgaccacgatttccgt
tgtgatgcctgtctcctgggctatgaaggacaacattgtgaaaggtgctccttgggctat
tatgggaaccctcaaacactaggtggcagttgccagaagtgtgactgcaaccctcacggc
tctgtccatggcgactgtgaccgcacatctgggcagtgtgtttgcaggctgggggcctcg
gggctccggtgcgatgagtgtgaaccgaggcacattctgatggaaacagattgtgtttcc
tgtgatgatgaatgtgtaggtgtgctgctgaatgacttggatgagactggtgatgccatt
ctttctctgaacctcactggcattatccctgtcccatatggaattttgtcaaagctggaa
aatacaactaaatatctccaggaatctttattaagagaaaatatgcaaaaggacctggga
agaattaagcttgaaggtgttgcagaagaaacggataacctgcaaaagaagctcactaga
atgttagcaagtacccaaaaggtgaacagggcaactgagagaatcttcaaggagagtcaa
gacctggccgtagccattgagaggttgcggatgaacatcacagaaattattgaaaagaca
actttaaatcagactttggatgaagatttcctgctacccaattctacgcttcagagcatg
caacaaaatgggacatctttgctggaaatcatgcagagaagagacgtcacacagttgcac
caaaatgccacccttgaactcaaggctgctgaagatttattgtcacaaattcaggaaaat
taccaaaagccgctggaagaattggaggtattgaaagaagcagcaagccacctcctttca
aagcacaacagtgaactaaaggcagctgaggtgcttgtgagggaagccgaggcaaagacc
gaggaaagcaaccacctgctgttcatggtcaatgctaacctgagagaattcagtgataaa
aagctacatgttcaagaagaacaaaatctgacctcagagctcattgcccaaggaagagga
ctgatagatactgctgctgcacaaacagacgctgtacaagatgctctagagcacttagag
catcaccaggatacgctacttttatggtctgccaaagtcaggcaccacgtagatgacctg
gtcatgcacatgtcccaaaggaacgcacttgacctggtctacagagctgaggaccatgcc
gctgagttccagagactagcagatgttctggacagtggccttgaaaatgtcagaaatgtg
tccctgaatgccaccagtgcagcctatgtccattacaacatccagaacctgatcgaagaa
tcggaggaactggccaaagatgctcacaggactgtgactgagatgagcctgctctcagaa
tcccttgtttctaatgggaaagcggccgtgcagcgcagctccagatttctaaatgaaggc
aacaacctcagcaggaagcttccagttattgcattggaactgagtgagctgagaaataag
acaaacagatttcaagagaatgctgatgaaattacccggcagaccaatgaatcagtcttg
atactcagagcaattcctgaagatacaagagacaaaggagccaaaaccaaagagctagcg
acgtctgcaagccagagcgcggtgagcacgctgagggacgtggcagggctgagccaggag
ctgctgagcacatctgccagcctgtccagggtcaacaccacattacaagagacgcaccag
cttctgcaggactccaccatggccactctgttggctggaagaaaagtcaaagacgtggaa
actcaagccaaccttttgtttgatcggttgaagcctttgaagatgttagaagagaatctg
agcagaaacctatcagaaattaaactgctcatcagccaggcccggaaacaagcggcttct
attaaagtcgctgtgtctgcagacagagattgcatccgggcctaccagcctcagatttcc
tctactaactacaacaccttaacactaaatgttaagacacaggaacccgataatcttctc
ttctacctcggtagcagcacctcttctgatttccttgcagtggagatgcggcgagggaaa
gtggccttcctgtgggacctgggctccgggtccacacgcttggagtttccagactttccc
attgatgacaacagatggcacagtatccatgccgccagatttggaaacattggttcactg
agtgtaaaggaaatgaactcaaatcaaaagctaccagcaaaaacaagtaaatcccctggg
acagctaatgttctggatgtaaacaattcaacactcatgtttgttggaggtcttggagga
caaatcaagaaatctcctgctgtgaaggttactcattttaaaggctgcttgggagaagcc
ttcctgaatggaaaatccattggcctatggaactatattgaaagggaaggcaagtgccat
gggtgcttcggaagctcccagaatgaagacccttccttccattttgacgggagtgggtac
tctgtcgtggagaagtcacttccggctaccgtgactcagataatcatgctttttaatacc
ttttcacctaatggacttcttctctacctgggttcatacggcataagagactttttatcc
atcgagctgttccatggcagagtgaaggttacgactgacctgggttcaggaccacttacc
cttttgacagacagacgttataacaatggaacctggtacaaaattgccttccagcgaaac
cggaagcaaggagtcctagcagttaacgatgcctttaacaccagtaataaagaaaccaag
cagggcgagactccgggagcatcttccgacctcaaccgtctagacaaggatccgattcat
gtgggtggattgccaaggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtg
ggctgcatcaagaacctggaaatatccagatcaacctttgacttactcagaaattcctac
ggagtgagaaaaggctgcttactggagcccatccggagcgttagcttcttgaaaggcggc
tacattgaattgccacccaagtctttgtcaccagaatcggaatggctggtaacatttgcc
accaagaacagcagtggcatcatcctggctgccctcggtggggatgcagagaagcagggt
gatcgtgaggagtcacacgtgcccttcttttccatcatgctgattggaggcaacattgag
gtacatgtcaatcctggggatggcacaggcctgaggaaagctctcctgcacgctcccacg
ggtacatgcagcgacggacaagcacattccatctccttggtcaggaatcggagaattatc
actgtccagttggatgagaacaatcctgtggaaatgaagttgggcccattagtagaaagc
aggacgataaatatgtccaatctgtacgtcgggggaattccagagggagaggggacatca
ctgctcacaacgagaagatcgttccatggttgtatcaaagacctgatctttaatttggga
cttttggatttcaacagtgcagttggccatgagcaagttgacttggacgcctgctggctg
tcagaaaggcctaagccggctcccgatgcagaggacagcgagctcttgccagacccccgg
gcttttccagtaggagcggcttcctttactatcagtcaggaacagtgtgtggtggatgca
gctctggagtacgttcctggcgcccaccagtttggtctctcacaaaacagccattttctg
ttgccttttaatcagtcggctgtcagaaagaggctctcggttgagctaagtatccgtacg
ttcgcctccagcggcctgatttactacatggctcatcagaaccaagcagactacgccgtg
ctccagctgcacgggggccgcctccacttcatgtttgaccttggcaaaggcagaacaaag
gtctctcaccctgcactgctcagcgatggcaagtggcacacggtcaagacacattatggt
aaaagaaaaggcttcatcacggtggacggccaagagtcccccatggtgactgtggtggga
gacggaaccgcgctggatgtggagggcttgttctacctaggaggcctgccctcccagtac
cgggccaggaaaattggaaatatcacccacagcatccctgcctgcattggggatgtgacg
gttaacagcaaacagctggacaaggacagcccggtgtccaccttcacagtgaacaggtgc
tacgcagcggcccaggaaggaacattctttgatggaagcggatacgcagctcttgtcaaa
gagggctacaaagtccagacggatgtgaacatcacactggaatttcgaacctcctcgcag
aatggcgtcctcctggggatcagcactgccaaagtggatgccattggactagagcttgtg
gatggcaaggtcttgttccatgtcaacaatggtgctggcaggataacagccacatatgag
cccaaaaccgccactgcgctctgtgatggaaaatggcacacgcttcaagctaacaaaagc
aaacaccgtatcactctgattgtcgatgggaacgcagttggcgctgaaagtccacacacc
cgctctacctcggtggacaccaacaatcccatttatgttggtggctatcctgctggcgtg
aagcaaaaatgcctgagcagccagacctcgttccgcgggtgtttgaggaagctagcgctg
atgaagaggccgcaggtgcaatcctttgacttcagcagagcgtttgaactgcacggagtt
ttccttcattcctgtcctgggacggagtcctga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527002
Entry
108527002         CDS       T04641                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta 2
  KO
K06243  laminin, beta 2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108527002 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108527002 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108527002 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527002 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108527002 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108527002 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108527002 (LAMB2)
   05145 Toxoplasmosis
    108527002 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Sec5
Other DBs
NCBI-GeneID: 108527002
NCBI-ProteinID: XP_017723589
UniProt: A0A2K6LG90
LinkDB
Position
Un
AA seq 1798 aa
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KVTNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLATGRGCDRCLPGHWGLSHDLLGCRLCDCDVGGALDPQCDEATGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLREGQALEFLVASVPKAMDYDLLLRLEPQVPEQWAELELTVQRPGPVPAHSLCGHVLPK
DDHIQGTLQPHARYIVFPNPVCLEPAISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRALVLEMFSGGDAAALERRATFERYQCQEEGLVPSKTSPSEACAPLLLSLSTLIYNGA
LSCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCPCRTGAFGLHCDRCQRGQWGFPNCRPCVCNGHADECDTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQKIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDHCA
PNFWNFTSGHGCHPCACHPRQARGPTCNEFTGQCYCHAGFGGRTCSECEELHWGDPGLQC
RACDCDPRGTDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGFFPACHPCHACFGDWDRV
VQDLAARTRRLEQRTQELQQTGVLGAFESSFWHIQERLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERCANTSALAVPSPVSNSASARHRTEALMDAQNEDFN
SKHMANQRALGKLSARTHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELRELVQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGV
AQGAIQGAVADTRDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt   +upstreamnt  +downstreamnt
atggagctgacctcaagggaaggagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggccgccacactggcacaggcccctgccccggatgtgcct
ggctgttcgaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacctgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggatgaaaagaagtgcttcctttgcgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaacgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccaactggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccctccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgttggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aaggtcaccaacctacgggtgaacctgactcgtctacacacattgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctatggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgaacagtgtcaggatttctatcatgacctgccctggcatccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gctgtatacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggc
ggtcgctgtgattcccatgatgaccctgcactgggactggtctcgggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccaacaatgccgtgatggcttctttgggctcagc
atcagtgaccctctgggctgccggcgatgtcagtgtaatgcacggggcacggtgcctggg
agtactccttgtgaccccaacagtggatcctgttattgcaaacgtctagcgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgc
ctctgtgactgcgacgtgggtggtgccttggatccccagtgtgatgaggccacaggtcaa
tgccactgccgccagcacatggtcgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaacttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggttactcccggggaaactccatcctggactggctcaggctttgtg
cggctacgggagggtcaggccctggagttcctcgtggcctctgtgccgaaggccatggac
tatgacctgctgctgcgcttagaaccccaggtccctgagcaatgggcagagttggaactg
actgtgcagcgtccagggcctgtgcctgctcacagcctgtgtgggcatgtgctgcccaag
gatgaccacatccaagggactctgcaaccacacgccaggtacatagtgtttcccaatcct
gtctgccttgagcctgctatctcctacaagctgcatctgaagctggtacgcacaggggga
agtgcccagcctgagactccctactctggacctggcctgctcattgactcgctggtgctg
ctgccccgtgccctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgc
cgggccacctttgaacgctaccaatgccaggaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcgcccctcctcctcagcctctccaccctcatctacaatggtgcc
ctgtcatgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggcggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccacgagggggcgctcagc
agtctctgtgaaaagaccagtgggcaatgtccctgtcgaactggtgcctttgggcttcac
tgtgaccgctgccagcgtggccagtggggattccctaactgccggccatgtgtctgcaat
gggcatgcagatgagtgcgacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccatggggacccacgactgccatat
gggggccagtgccggccctgtccatgtcctgaaggtcctgggagccagcggcactttgct
acttcttgccaccgggatgaatattcccagaagattgtgtgccactgccgggcaggctac
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccatgggcaggctgcccgacagagctgtcaccgctgcacctgc
aacctgctgggcacaaatccccagcagtgcccgtctcctgaccagtgccactgtgatcca
agcagtgggcagtgcccatgcctccccaatgtccagggccctagttgtgaccactgtgcc
cccaacttctggaacttcaccagcggccatggttgccatccttgtgcctgccacccaaga
caggccagaggccccacctgcaatgagttcacagggcagtgctactgccatgccggcttt
ggagggcggacttgttctgagtgcgaagagctccactggggagaccctgggttgcagtgc
cgtgcctgtgattgtgaccctcgtggaacagataaacctcagtgtcaccgctccacaggt
cactgcagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgcccgtggcttc
tcaggattctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggctgcccgtacacggcgcctagagcagcggacacaggagttgcagcag
acgggtgtgctgggtgcctttgagagcagcttctggcatatacaggagaggctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattggggaggccactgagcacctgactcaactggag
gcagagctgacagatgtgcaggatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagacaggcttgcacttaatctcacactgcggcagctggaccagcatcttgacttg
ctcaaacattcaaacttcctaggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgttgtgccaacacctcggccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgcccagaatgaggacttcaac
agcaaacacatggccaaccagcgagccctgggcaagctctctgcccgtacccacaccctg
agcctgacaggcataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccccgctgtgggggcctc
agctgcaatggggcagcggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagtgaggcacagcagcgggcccaggcagctctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcgagaacttgtccagagtgtgaag
gacttcctcaaccaggagggggctgatcctgatagcattgagatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgca
gagcgagtccggagcctggcggatgtggacgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagttactgcaggatgcacggcgggcaaggagccgggctgagggtgag
aaacagaaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtgtt
gcccagggtgccatccagggggcagtggctgacacacgggacacagagcagaccctatac
caggtacaggagaggatggcaggtgcagagcaggcactgagctctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaagttgaaacgggcgggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacggggccctctgggtgatcagtaccagacggtgaaggccctggctgagcgcaag
gcccagggtgtgctagctgcacaggcaagggcagagcaactgcgggatgaggctcgggac
ctgttgcaggccgctcaggacaagctgcagcggctacaggaactggaaggcacctatgag
gagaatgagcgggcactggagggtaaggcagcccagctggacgggctggaggccaggatg
cgcagtgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527057
Entry
108527057         CDS       T04641                                 

Gene name
COL4A1
Definition
(RefSeq) collagen type IV alpha 1 chain
  KO
K06237  collagen type IV alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04974  Protein digestion and absorption
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108527057 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108527057 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108527057 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108527057 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    108527057 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527057 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108527057 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108527057 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108527057 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108527057 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108527057 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108527057 (COL4A1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108527057 (COL4A1)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108527057 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 108527057
NCBI-ProteinID: XP_017723683
LinkDB
Position
Un
AA seq 1678 aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGL
PGNPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGS
PGFPGEPGYPGLVGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGP
KGFPGLPGQAGPPGLPVPGQAGAPGFPGERGEKGDRGFPGASLPGPSGRDGLPGPPGSPG
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGLIGEIGEKGKILXFFKKWSKGESCLICD
TTGYRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPG
EIYFDLRLKGDKGDPGFPGQPGIPGRAGSPGRDGRPGLPGPKGSPGSVGLKGERGPPGGV
GFPGSRGDTGPPGPPGYGPTGPIGDKGQAGFPGGPGSPGLPGPKGEPGKVVPLPGPPGAE
GLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQQGIGFPGPPGPKGVDGLPGDVGPPG
TPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIAGTPGEKGSVGVPGVPGEHGA
IGPPGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFP
GFPGLDMPGPKGDKGSQGLPGITGQSGLPGLPGQQGSPGIPGFPGSKGEMGVMGTPGQPG
SPGPVGVPGLPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKG
DQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKG
SVGGMGLPGTPGEKGVPGIPGPQGSPGSPGEKGAKGAKGQAGPPGIGIPGLPGEKGDQGI
AGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGV
KGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGEV
GFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGRATEGPKGDRGPQGQPGLPGLPG
PMGPPGLPGIDGVKGDKGNPGWPGAPGVPGSKGDPGFQGMPGIGGSPGITGSKGDMGPPG
VPGFQGPKGLPGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLK
GLQGPPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPTGPTGPRGFPGPPGPDGLP
GSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAG
SCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDNIRPFISRCAVC
EAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSA
PFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5037 nt   +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggctgctgctgctgcccgccgcccttctgctccacgag
gagcacagccgggccgctgcgaagggtggctgtgctggctctggctgtggcaaatgtgac
tgccatggagtgaagggacaaaagggcgaaagaggcctcccagggttacaaggtgtcatt
gggtttcctggaatgcaaggacctgaggggccgcagggaccaccaggacaaaagggtgat
actggagaaccaggactacctggaacaaaagggacaagaggacccccgggagcatctggc
taccctggaaacccaggacttcccggtattcctggccaagacggcccaccaggcccccca
ggtattccaggatgcaatggcacaaagggagagagagggccgctcgggcctcctggcttg
cctggttttgctggaaatcccggaccaccagggttaccaggaatgaagggtgatccaggt
gagatacttggccatgtgcccgggatgctgttgaaaggtgaaagaggatttcccggactc
ccagggaatccaggcccaccaggattgccaggacttcaaggtcctgttgggcctccagga
tttaccggaccaccgggtcctccaggtcctcccggccctccaggtgaaaagggacaaatg
ggcttaagttttcaaggacccaaaggtgacaagggtgaccaaggggtcagtgggcctccg
ggagtaccaggacaagcccaagttcaagaaaaaggagattttgccaccaagggagaaaag
ggccaaaaaggtgaacctggatttcagggaatgccaggggtcggagagaaaggtgaaccc
ggaaaaccaggacccagaggaaaacctggaaaagatggtgacaaaggggaaaaagggagt
cccggttttcctggtgaacccgggtacccaggactcgtaggccgccagggcccgcaggga
gaaaagggtgaagcaggtcctcctggcccaccaggaattgttataggcacagggcctttg
ggagaaaaaggagagcggggctaccctggaactccagggccaagaggagagccaggcccg
aaaggtttcccaggactaccaggccaagccggacctccaggcctccctgtacctgggcag
gctggtgcccctggcttccctggtgaaagaggagaaaaaggtgaccgaggatttccgggt
gcatctctgccaggaccaagtggaagagacgggctcccgggtcctcctggttcccccggg
ccccctgggcagcctggctacacaaatggaattgtggaatgtcagcccggacctccaggt
gaccaaggtcctcctggaattccagggcagccaggattgataggcgaaattggagagaaa
ggtaagatactttgattttttaaaaaatggtcaaaaggagagagttgcctcatctgtgat
acaactggatatcgggggcctcccgggccacagggacccccaggagaaataggtttccca
ggacagccaggggccaagggcgacagaggtttgcctggcagagatggtgttgcaggagtg
cctgggcctcaaggtacaccagggctgataggccagccaggagccaagggggagcctggt
gagatttatttcgacctgcggctcaaaggtgacaaaggagacccaggctttccaggacag
cccggcataccagggagggcgggttctcctggaagagatggccgtccgggtcttcctggc
cccaagggctcgccgggttctgtaggattgaaaggagagcgtggcccccctggaggagtt
ggattcccaggcagtcgtggtgacaccggcccccctgggcctccaggatatggtcctact
ggtcccattggtgacaaaggacaagcaggctttcctggaggccctgggtccccaggcctg
ccaggtccaaagggtgaaccaggaaaagttgttcctttaccaggcccccctggagcagaa
ggactgccggggtccccaggcttcccaggtccccaaggagaccgaggctttcctggaacc
ccaggaaggccaggcctgccaggagagaagggtgctgtgggccagcagggaattggattt
ccagggccccctggccccaaaggtgttgacggcttacctggagatgtggggcctccaggg
actccaggtcgcccaggatttaatggcttacctgggaacccaggtgtgcagggccagaag
ggagagcctggagttggtctgccgggactcaaaggtttgccaggtctacccggcattgct
ggcacacccggggagaaggggagcgttggggtaccaggcgttcctggagaacacggagcg
atcggaccccctgggcttcaggggatcagaggtgaaccggggcctcctggattgccaggc
tccgtggggtctccaggagttccaggaattggcccccctggagctaggggcccccctgga
ggacagggaccaccggggttgtcgggccctcctggaataaaaggagagaagggtttcccc
ggattccccggactggacatgccaggccctaaaggagataaagggtctcaaggacttcct
ggcataacaggacagtcagggctccctggccttcctggacagcaggggtctcctggcatt
cctgggtttccaggttccaagggagaaatgggcgtcatggggaccccagggcagccgggc
tcaccaggaccagtgggtgttccgggattaccgggtgaaaaaggggaccatggctttccg
ggctcctcaggacccaggggagaccctggcctgaaaggtgataagggggatgtcggtctc
cctggcaagcctggctccatggataaggtggacatgggcagcatgaagggccagaaggga
gaccaaggagagaaaggacaaattggaccaattggtgagaaaggatcccgaggagaccct
gggaccccaggagtgcctggaaaggatgggcaggcaggacagcctgggcagccaggaccg
aaaggtgatccaggtataagtggaaccccaggtgctccaggacttccgggaccaaaagga
tctgttggtggaatgggcttgccaggaacacctggagagaaaggtgtgcctggcatccct
ggcccacaaggttcacctggctcacctggagaaaaaggtgcaaaaggagcgaaagggcag
gcaggcccacctggcataggcatcccagggctgcctggtgaaaagggagatcaagggata
gcgggtttcccaggaagccctggagagaagggagaaaaaggaagcattgggatcccagga
atgccagggtccccaggccttaaagggtctcctgggagtgttggctatccagggagccct
gggctgcctggagaaaaaggtgacaaaggcctcccaggattggatggcatccctggtgtc
aaaggagaagcaggtcttcctgggacgcctggccccacaggcccagctggccagaaaggg
gagccaggcagtgacggaatcccggggtcagcaggagagaagggtgaaccaggtctacca
ggaagaggattcccagggtttccaggggccaaaggagacaaaggttcaaagggcgaggtg
ggtttcccaggattagccgggagcccaggaattcctggatccaaaggagagcaaggattc
atgggtcctccagggccccagggacaaccagggttaccaggatccccaggccgtgccacg
gaggggcccaaaggagaccgtggacctcagggccagcctggcctgccaggacttccggga
cccatggggcctccggggcttcctgggattgatggagttaaaggtgacaaaggaaatcca
ggctggccaggagcacccggtgtcccagggtccaagggagaccctggattccagggcatg
cctggtattggtggctctccaggaatcacaggctctaagggtgatatggggcctccagga
gttccaggatttcaaggtccaaaaggtcttcctggcctccagggaattaaaggtgatcaa
ggcgatcaaggtgtcccgggagctaaaggtctcccgggtcctcctggccccccaggtcct
tacgacatcatcaaaggggagcccgggctccctggtcctgagggtcccccagggctgaaa
gggcttcagggacctccaggccccaaaggccagcaaggtgttacaggattggtgggtatc
cctggacctccaggtatccctgggttcgacggtgcccctggccagaaaggagagatggga
cctaccgggcctactggtccaagaggatttccaggtccaccaggccctgatgggttgcca
gggtccatggggcccccaggcaccccatctgttgatcatggcttccttgtgaccaggcac
agtcaaacaatagacgacccacagtgtccctctgggaccaaaattctttaccatgggtac
tctttgctctacgtgcaaggcaacgaacgggcccatggccaggacttgggcacggccggc
agctgcctgcgcaagttcagcacaatgcccttcctgttctgcaatattaacaacgtgtgc
aactttgcatcacgaaatgactactcgtactggctctccacccccgagcccatgcccatg
tcaatggcacccatcacgggggacaacataagaccatttattagtaggtgtgctgtgtgt
gaggcgcccgccatggtgatggccgtgcacagtcagaccattcagatcccaccgtgcccc
agcgggtggtcctcgctgtggatcggctactcttttgtgatgcacaccagcgctggtgca
gaaggctctggccaagccctggcatcccctggctcctgtctggaggagtttagaagtgcg
ccattcatcgagtgtcacggccgtgggacctgtaattactacgcaaatgcttacagcttt
tggctcgccaccatagagaggagcgagatgttcaagaagcccacgccgtccaccttgaag
gcaggggagctgcgcacacacgtcagccgctgccaagtctgtatgagaagaacataa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527058
Entry
108527058         CDS       T04641                                 

Gene name
COL4A2
Definition
(RefSeq) collagen type IV alpha 2 chain
  KO
K06237  collagen type IV alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04974  Protein digestion and absorption
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108527058 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108527058 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108527058 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108527058 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    108527058 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108527058 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108527058 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108527058 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108527058 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108527058 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108527058 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108527058 (COL4A2)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108527058 (COL4A2)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108527058 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 108527058
NCBI-ProteinID: XP_017723684
UniProt: A0A2K6LWB6
LinkDB
Position
Un
AA seq 1712 aa
MGRDQRAVAGPALRRWLLLGTVTVGFLAQGVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPREERD
RYRGEPGEPGLVGFQGPPGRPGPVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKG
EKGDVGQPGPNGIPSDLLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGF
PGLRGYPGLSGEKGSSGQKGSRGLDGYQGPDGPRGPKGEAGDLGPPGLPAYSPHPSLAKG
ARGDPGFPGAQGEPGSQGEPGDPGPRGPPGLSIGDEDQRRGLPGEMGPKGFIGDPGIPAL
YPGPPGPDGRPGPPGPPGLPGPPGPDGFLFGLKGAEGRAGFPGLSGSPGARGPKGWKGDA
GDCRCAEGDEPVRGPPGLPGPKGFAGINGEPGRKGDKGDPGQHGLPGFPGLKGVPGNVGA
PGPKGAKGDSRTITTKGERGQPGVPGVPGMKGDDGGPGRDGLDGFPGLPGPPGDGIKGPP
GDAGYPGIPGTKGTPGEVGPPGLGLPGFKGQRGFPGDAGLPGPPGFPGPPGPAGTPGQRD
CDTDVKRPIGGDRQEAIQPGCVGGPKGLPGLPGPPGPSGAKGLRGIPGFSGADGGPGPKG
LPGDPGREGFPGPPGFIGPRGSKGAVGLPGPDGPPGPIGLPGPDGPPGDRGLPGEVLGAQ
PGPRGDAGVPGQPGFKGLPGDRGPPGFRGSQGMPGMPGPKGQPGLPGPSGQPGLSGPPGQ
HGFPGAPGQEGPLGLPGIPGLEGLPGDRGDPGDIGAPGPVGMKGLSGDRGDAGLAGERGH
PGSPGFKGIDGMPGTPGLKGERGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGV
AGEPGFKGSRGDPGPPGPPPIILPGMKDIKGEKGDEGPMGLKGYLGAKGIPGMPGIPGLS
GIPGLPGRPGHIKGVKGDIGAPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL
YGEIGPTGDFGDIGDTINLPGRPGLKGEQGTAGIPGLKGFFGEKGTEGDIGFPGITGVTG
VQGPPGLKGQTGFPGLTGPPGSQGQPGRIGLPGGKGDDGWPGTPGLPGFPGLRGIRGLHG
LPGTKGFPGSPGADIHGDPGFPGPPGDRGDPGDANTLPGPVGVPGQKGEQGAPGERGPPG
SPGLQGFPGITPPSNISGVPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPG
TPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPAGAVGDRGPKGPKGDPGFPG
APGIVGAPGIAGIPQKIAIPPGTVGPQGRRGPPGAQGEMGPQGPPGEPGFRGAPGKAGPQ
GRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSASIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5139 nt   +upstreamnt  +downstreamnt
atggggagagaccagcgcgcggtggccggccctgccctacggcggtggctgctgctgggg
acagtgaccgtggggttccttgcccagggcgtcttggcgggtgtgaagaagtttgatgtg
ccgtgcggaggaagagattgcagtgggggctgccagtgctaccctgagaaaggtggacgt
ggtcagcctgggccagtggggccccaggggtacaatgggccaccaggattacaaggattc
ccaggactgcagggacgcaaaggagacaagggtgaaaggggagcccccggaataacagga
cccaagggcgacgtgggagcaagaggcgtttctggattccctggtgccgatggaattcct
ggacacccggggcaaggtgggcccaggggaaggcccggctatgatggctgcaacggaacc
cagggagactcaggtccacagggcccccccggctctgaggggttcaccgggcctcccggg
ccccaaggaccaaaagggcagaaaggtgagccttatgcactgcctagagaggaacgcgac
agatatcggggcgaacctggagagcctggattggtcggtttccagggacctcccggccgc
cctgggcctgtggggcagatgggcccagttggagctccagggagaccaggaccacccgga
ccccctggaccaaaaggacagcaaggcaacagaggacttggtttctacggagttaagggt
gaaaagggtgacgtagggcagccaggacccaatgggattccatcggaccttctgcacccc
atcatcgcgcccacaggagtcaccttccacccagatcagtacaagggtgaaaaaggcagt
gagggggaaccaggaataagaggcatttccttgaagggagaagaaggaatcatgggcttt
cctggactgaggggttaccctggtttgagtggtgaaaaaggatcgtcaggacagaaggga
agccgaggcctggatggctaccaaggccctgatgggccccggggacccaagggagaagcc
ggagacctagggccccctggactacctgcctactcccctcacccttccctagcaaaaggt
gccagaggtgacccgggattcccaggggcccaaggggagccaggaagccagggtgagcca
ggagacccgggcccccgaggaccccctggcctctccatcggagatgaagatcagaggaga
ggcctgccgggtgagatgggacccaagggcttcatcggagaccccggcatccctgcgctg
tacccgggcccacctggacctgatggaaggccagggcctccaggcccccccgggctccct
ggaccacctggacctgatggcttcctgtttgggctgaaaggagcagaaggaagagcaggc
tttcctgggctttccggctcccctggagcccgcggaccaaagggatggaaaggtgacgct
ggggactgcagatgtgcagaaggcgacgaacctgtcagaggtcctccaggactgccagga
cccaagggctttgcaggcatcaacggggagccggggaggaaaggggacaaaggagacccc
ggccaacatggcctccctgggttcccagggctcaagggagtccctggcaacgttggtgct
cctgggcccaaaggagcaaaaggagattccagaacaatcacgaccaaaggtgagcgggga
cagcccggcgtcccaggtgtgcccgggatgaaaggtgatgatggcggcccaggccgcgat
gggctcgatggattccccggcctcccaggccctcccggcgatggcatcaagggccctccc
ggggacgcaggctatccaggaatacctggaacgaaaggtactccaggagaagtgggtccc
ccaggactgggccttcccggcttcaaaggccagcgtggtttccctggagacgccggctta
cctggaccaccaggcttcccgggccctcctggccccgcagggaccccaggacaaagagat
tgtgacacagatgtgaaaaggcccattggaggtgacagacaggaggccatccagccaggt
tgcgtaggagggcccaagggattaccaggcctgccaggacccccaggaccctcaggtgcc
aaaggcctccgaggaatcccaggcttctcaggagctgatggaggaccagggcccaagggt
ttgccaggagacccaggtcgtgaagggttcccaggacccccagggttcataggaccccga
ggatccaaaggtgcagtgggcctccctggcccagatggacccccaggtcccatcggcctg
ccagggccagacgggccccctggggacaggggccttcctggagaagtcctgggagcccag
cccggaccacggggagatgctggtgtgcctggacagcctgggtttaaaggccttcccgga
gacagaggcccccctggattcagaggaagtcaagggatgcctgggatgccagggccgaag
ggccagccaggccttccgggaccttccggccagccaggcctgtccgggcctccaggacag
catggattcccaggagctcctggccaagaggggcccttggggctgccaggaatcccaggt
cttgaaggtctgcctggagatagaggggaccctggggacataggcgctcctggccctgtg
ggcatgaaaggtctctctggtgacagaggggatgcaggcttggcaggggagcgaggccat
ccaggaagccctggatttaaaggaattgatggaatgcctgggacccccgggctaaaagga
gagagaggctcacctgggatggatggtttccagggcatgcctggactcaaagggagaccc
ggctttccagggagcaaaggcgaggctggatttttcggaataccgggtctgaagggtgtg
gctggtgagccaggttttaaaggcagccgaggggaccctgggcccccaggaccacctccc
atcatcctgccaggaatgaaagacattaaaggagagaaaggagacgaagggcctatggga
ctgaaagggtacctgggcgcaaaaggtatcccaggaatgccaggcatcccaggactgtca
ggaatccctgggctgcctgggaggcccggccacatcaaaggagtcaaaggagacatcgga
gccccgggcatccctggtttgccaggattccctggggtggctggcccccctggaattaca
gggttcccaggattcataggaagccggggtgacaaaggcgccccagggagagcaggcctg
tatggcgagatcggcccaaccggtgatttcggtgacatcggggacactataaatttacca
ggaagaccaggcctgaagggggagcagggcaccgctggaataccaggtctgaagggattc
tttggagagaagggaacagaaggtgacatcggcttccctgggataacaggcgtgactgga
gtccaaggccctcctgggcttaaaggacaaacaggctttccagggctaactgggcctcca
gggtcgcagggacagccggggcggattggactgcctggtggcaaaggagatgatggctgg
ccgggaactccaggcttaccaggttttccgggactccgtgggatccgcggcttacacggc
ttgccaggcaccaaaggctttccaggatccccaggtgccgacatccacggagacccaggc
ttcccaggccctcctggggacagaggtgacccaggagacgccaacacccttccaggccct
gtgggagtcccaggacagaaaggagagcaaggagctccaggggaacgaggcccacctggg
agtccaggacttcaggggttccccggcatcacgcccccttccaacatctctggggtacct
ggtgacaaaggggcgccagggatatttggcctgaaaggttatcggggcccgccagggcca
cccggatctgctgctcttcctggaagcaaaggtgacacagggaacccaggagctccagga
accccagggaccaaaggatgggccggggactccgggccccagggcaggcctggtgtgttc
ggtctcccgggagaaaaagggcccaggggtgaacaaggctttatggggaacactggaccc
gccggcgcggtgggcgacagaggccccaagggacccaagggagacccaggattccctggt
gcccccgggattgtgggagcccctggaattgcaggaatcccccagaagattgccatccca
ccagggacagtgggtccccaggggaggcgaggcccccctggggcacaaggggagatgggg
ccccagggccctcccggagaaccaggtttccgtggggctccagggaaagccgggccccaa
ggaagaggtggcgtgtctgctgttcccgggttccggggagatgaaggacccataggccac
caggggccgattggccaagaaggggcgccaggccgtccggggagcccaggcctgccgggt
atgccaggccgcagcgccagcatcggctacctcctggtgaagcacagccagacagaccag
gagcccatgtgcccggtgggcatgaacaagctctggagtgggtacagcctgctgtacttc
gagggccaggagaaggcacacaaccaggacctggggctggcgggctcctgcctggcgcgg
ttcagcaccatgcccttcctgtactgcaaccctggtgatgtctgctactacgccagccgg
aacgacaagtcctactggctctctaccactgctccgctgcccatgatgcctgtggccgag
gatgagatcaagccctacatcagccgctgctctgtgtgtgaggccccagccgtcgccatt
gccgtccacagtcaagatgtctccattccacactgcccagcggggtggcggagtttgtgg
atcggatattccttcctcatgcacacggcggcgggagacgaaggcggcggccagtcactg
gtgtcaccgggcagctgtctggaggacttccgcgccacgccattcatcgagtgcaatgga
ggccgcggcacctgccactactacgccaataagtacagcttctggctgaccaccattccc
gagcagagcttccagggctcgccctccgctgacacgctcaaggccggcctcatccgcaca
cacatcagccgctgccaggtgtgcatgaagaacctgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534366
Entry
108534366         CDS       T04641                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha 2
  KO
K05637  laminin, alpha 1/2
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
rbb05410  Hypertrophic cardiomyopathy
rbb05412  Arrhythmogenic right ventricular cardiomyopathy
rbb05414  Dilated cardiomyopathy
rbb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108534366 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108534366 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108534366 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108534366 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108534366 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108534366 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108534366 (LAMA2)
   05414 Dilated cardiomyopathy
    108534366 (LAMA2)
   05416 Viral myocarditis
    108534366 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108534366 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108534366 (LAMA2)
   05145 Toxoplasmosis
    108534366 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 LXG DUF948 HSBP1
Other DBs
NCBI-GeneID: 108534366
NCBI-ProteinID: XP_017735168
LinkDB
Position
Un
AA seq 3122 aa
MPGAAGVLLLLLLSGGLRGGQAQLPQQQRRPQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRSLSLNIHGKYIGGGVCINCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCNPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCNCKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLSGRIRVAPQQDDSDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTEHVLQFMIILEGNDLRISTAQDEVYLHPSEEHTNVLVLKEESF
TIHGTHFPVSRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSVAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDQCLPGFYGDPTKGTSEDCQPCACPLNIPSNNFSPTCHLDQSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDARNCQPCHCNANGSFSEICHRQTGQCECRANVQGQRCDKCKPGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDAATCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCQPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIAFQHPEIVAHMDLMREDLRWEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRRTAVTPPAHLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVTEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGICTCRPGATGRKCDGC
KHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMIQELK
HLLSPQQAPERLIQLAEGDLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEGIRKKAIKLNETLGTRDEAFERNLERLQKEIDQMIKELRRRNLETQKEIA
EDELVAAEGLLKKVKKLFGESRGKNEEMEKDLREKLADYKNKVDDAWDLLREATNKIREA
NRLFAVNQKNMTVLEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNNKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGSLQKSFRILNE
AKKLANDVKENEDHLNGLKTRIENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQIKQLHQNLDGLKKNYDKLADSVAKTNAVVKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRRGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIMASRTGRNGTISVRALDGPKASIVPSTYHSTSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKHANISIVDIDTNQEENIATSSSGNNFGL
DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG
CSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQ
TGQAYYAILLNRGRLEVHLSTGARTMRKIVVRPEPNLFHDGREHSVHVERTRGIFTVQVD
ENRRYMQNLTVEQPLEVKKLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSVPMDFARPV
SFKNADIGRCVHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALL
IGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRN
GLPYFSYDLGSGDTNTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPRKADILD
VVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNLHMEEAPADLEEPTSSFHVGTCFANAQR
GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFH
VDNGAGRFTAIYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSLNPASTSADT
NDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP
AN
NT seq 9369 nt   +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctcctcctgctgctctccgggggcctcaggggcggt
caggcgcagctgccgcagcagcagcggcggccacaggcacatcagcaaagaggtttattc
cctgctgtcctgaatcttgcttctaatgctcttatcacaaccaatgcaacatgtggagaa
aagggacctgaaatgtactgcaaattggtggaacatgtccctgggcagcctgtgaggaac
ccccagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccgattaca
aatgctattgatggaaagaacacttggtggcagagtcccagtattaagaatggaatcgaa
taccattacgtgacaattacactggatttacagcaggtgttccagattgcatatgtgatt
gtgaaggcagctaactcccctcggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagatacggagtgcctaaccctttac
aatatttatccccgcactgggccaccgtcatatgccaaagacgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
ggaagaccaagtgccgatgatccttctccagaactgctggagtttacctctgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatattactactcggtcaaggat
atttcagttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcaacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctaactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaagtctgagtttgaatatacatggaaagtacattggagggggtgtttgcattaat
tgtacccaaaatactgctggtataaactgtgagacatgtattgatggcttcttcagaccc
aaaggggtatcgccaaattatccaaggccatgccagccatgtcattgcaatccaattggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcaaaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccagactgcaaagcctgtaactgcagtggcttagggagcaaaaatgaggac
ccttgttttggcccctgtaactgcaaggagaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaaggctgcgatgagtgtttctgt
tcaggtgtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgacctttctggccgcattcgagtggctccccagcaggacgac
tcggactcacctcagcagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcaccagctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgacctggaagaagaggaagaagatacagaacatgtt
ctccagtttatgattatcttagagggtaatgacttgagaatcagcacagcccaagatgag
gtgtacctgcacccatctgaagaacatactaatgtattagtacttaaagaagaatcattt
accatacatggcacacattttccagtcagtagaaaggaatttatgacagtacttgcgaat
ttgaagagagtcctcctacaaatcacatacagctttgggatggatgccatcttcaggttg
agctctgttaaccttgaatctgctgtctcctatcctactgatggaagcgttgcagcagct
gtagaagtatgtcagtgcccaccagggtatactggctcctcttgtgaatcttgttggcct
aggcacaggcgagttaacggcaccatttttggtggcatctgtgagccatgtcagtgcttt
ggtcatgcggagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacaca
ggcggcccatattgtgatcaatgtcttcctggtttctatggcgatcctactaaaggaacc
tctgaagactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagccca
acgtgccatttagaccagagtcttggattgatctgtgatggatgccctgtcgggtacaca
ggaccacgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggagga
tcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgac
agcttgtctggctcctgtctgatatgtaaaccaggtacaacaggccggtactgtgagctc
tgtgctgatggatattttggagacgcagttgatgcaaggaactgtcagccctgtcactgt
aatgccaatggctctttctctgagatttgccaccgtcaaactggacagtgtgagtgcaga
gccaacgtgcagggccagaggtgtgacaaatgcaagcctgggacctttggtctgcaatca
gcaaggggctgtgttccctgcaactgcaattcttttgggtctaagtcattcgactgtgaa
gagagtggacaatgttggtgccaacccggagtcacagggaagaaatgtgaccgctgtgcc
catggttatttcaacttccaagaaggaggctgcacagcttgtgaatgttctcatctgggt
aataattgtgacccaaagactgggcgatgcatttgccctcccaataccattggagagaaa
tgttctaaatgtgcacccaatacctggggccacagcattaccactggttgtaaggcttgt
aactgcagcacagtgggatccttggatttccaatgcaatgtaaatacaggccaatgcaac
tgtcatccaaaattctctggtgcaaaatgtacagagtgcagtcgaggtcactggaactac
cctcgctgcaatctctgtgactgcttcctccctgggacggatgccgcaacctgtgattca
gagactaaaaaatgctcctgtagtgatcaaactgggcagtgcacttgtaaggtgaatgtg
gaaggcatccactgtgacagatgccagcctggcaaattcggactcgatgccaagaatcca
cttggctgcagcagctgctattgcttcggcactactactcagtgctctgaagcaaaagga
ctgatccggacgtgggtaactctgaaggctgagcagaccattctacccctggtagatgag
gctctgcagcacacaaccaccaagggcattgcttttcaacatccagagattgttgcccac
atggacctgatgagagaagatctccgttgggaacctttttattggaaacttccagaacaa
tttgaaggaaagaagttgatggcctatgggggcaaactcaagtatgcaatctatttcgag
gctcgggaagaaacaggtttttctacatataatcctcaagtgatcattcgaggtgggaca
cctactcatgctagaattatcgtcaggcatatggctgctcctttgattggccaattgaca
aggcatgaaattgaaatgacagagaaagaatggaaatattatggggacgatcctcgagtc
catagaactgtgacccgagaagacttcttggatatactgtatgatattcattacattctt
atcaaggctacttatggaaatttcatgcgacaaagcaggatttctgaaatctcaatggag
gtagctgaacaaggacgtagaacagcagtgactcctccagctcacttgattgaaaaatgt
gattgccccctgggctattctggcctgtcctgtgaggcatgcttgccaggattttatcga
ctgcgttctcaaccaggtggccgcacccctggaccaaccttgggcacctgtgttccatgt
caatgtaatggacacagcagcctgtgtgaccctgaaacatcgatatgccagaattgtcaa
catcacactgctggtgacttctgtgaacgatgtgctcttggatactatggaattgtcaag
ggattgccaaatgactgtcagcaatgtgcctgccctctgatttcttccagtaacaatttc
agcccctcttgtgtcacagaaggccttgatgactaccgctgcacggcttgtccacgggga
tacgaaggccagtactgtgaaaggtgtgcccctggctatactggcagtccaagcagccct
ggaggctcctgccaagaatgtgagtgtgatccctatggctcactgcctgtgccctgtgac
cctgtcacaggaatctgcacgtgccgacccggagccacgggaaggaagtgtgacggctgc
aagcactggcatgcacgcgagggctgggagtgtgttttttgtggagatgagtgcactggc
cttcttctcggtgacttggctcgcctggagcagatggtcatgagcatcaacctcactggt
ccgctgcctgcgccatataaaatgctgtatggtcttgaaaatatgattcaggagctaaag
cacctgctctcacctcagcaggccccagagaggcttattcagctggcagagggcgatctg
aatacactcgtgaccgaaatgaacgagctgctgaccagggctaccaaagtgacagcagat
ggcgagcagaccggacaggatgctgagaggaccaacacaagagcaaagtccctgggagaa
ttcattaaggagcttgcccgggatgcagaaggtattagaaaaaaagctataaaactaaat
gaaactctaggaactcgagacgaggcctttgagagaaatttggaaaggcttcagaaagag
attgaccagatgattaaagaactgaggaggagaaatctagagacacaaaaggaaattgct
gaagacgagttggtagctgcagaaggccttctgaaaaaggtgaaaaagctgtttggagag
tcccggggaaaaaatgaagaaatggagaaggatctccgagaaaaactggcagactacaaa
aacaaagttgatgatgcttgggacctgttgagagaagccacgaataaaatcagagaagct
aatcgcttatttgcagtaaaccagaaaaacatgactgtgttggagaaaaagaaggaggct
gttgaaagtgggaaacgacaaattgagaacactttaaaagagggcaatgacatactcgat
gaagccaaccgtcttgcagatgaaatcaactccatcatagattatgttgaagacatccaa
actaaattgccacctatgtctgaggagcttaacaacaaaatagatgacctctcccaagaa
ataaaggacaggaagcttgccgagaaggtgtcccaggctgagagccacgcagctcagttg
aatgactcatctgctgtccttgatggaatccttgatgaggctaaaaacatctccttcaat
gccactgcagccttcaaagcttacagcaatattaaggactatattgatgaagctgagaaa
gttgccaaagaagccaaagatcttgcacatgaagctacgaaactggcaacaggtcctcgg
ggtttgttaaaggaagatgccaaaggctctcttcagaaaagcttcaggattcttaacgaa
gccaagaagttagcaaatgatgtaaaagaaaatgaagaccatctaaatggcttaaaaacc
aggatagaaaatgctgatgctagaaatggggatctcttgagagctttgaatgacactttg
ggaaagttatcagctattccaaatgacacagctgctaaactgcaagctgttaaggacaaa
gccagacaagccaacgacacagctaaagatgtactggcacagattaaacagctccatcag
aacctcgatggcctgaagaagaattacgataaactagcagacagcgtcgccaaaacgaat
gctgtggttaaagatccctccaagaacaaaatcattgccgacgcagatgccactgtcaaa
aatctagaacaggaagctgaccggctaatagataaactcaaacccatcaaggaacttgag
gataatctaaagaaaaacatctctgagataaaggaattgataaaccaagctcggaaacaa
gccaattctatcaaagtatctgtgtcttcgggaggtgactgcattcgaacatacaagcca
gaaatcaagaaaggaagttacaataatattgttgtcaatgtaaagacagctgttgctgac
aacctcctcttttatcttggaagtgccaaatttattgactttctggctatagaaatgcgt
agaggcaaagtcagcttcctctgggatgttggatctggagttggacgtgtagagtaccca
gatttgactattgatgactcatattggtaccgtatcatggcatcaagaactgggagaaat
ggaactatttctgtgagagccctggatggacccaaagccagcattgtacccagcacatac
cattcgacgtctcctccagggtacactattctagatgtggatgcaaatgcaatgctgttt
gttggtggcctgactgggaaattaaagaaggctgatgctgtacgtgtgattacattcacc
ggctgcatgggagaaacatactttgacaacaaacctataggtttgtggaatttccgagaa
aaagaaggtgactgcaaaggatgcactgtgagtcctcaggtggaagatagtgaggggact
attcagtttgatggagaaggttatgcattggtcagccgccccattcgctggtaccccaac
atctccactgtcatgttcaagttcagaacattttcttcgagtgctctcctgatgtatctt
gccacacgagacctgagagatttcatgagtgtggagctcactgatgggcacataaaagtc
agttatgatctgggttcgggaatggcttccgttgtcagcaatcaaaaccataatgatggg
aaatggaaatcattcaccctgtcaagaattcaaaagcacgccaacatatcgattgtagat
atagatactaatcaggaggagaacatagcaacttcatcttctggaaacaactttggtctt
gacttgaaagcagatgacaaaatatattttggtggcctgccaacgctgagaaacttgagt
atgaaagcaaggccagaagtaaatctgaagaaatattccggctgcctcaaagatattgaa
atttcaagaacgccgtacaatatcctcagtagtcccgattatgttggtgttaccaaagga
tgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggagctctcc
cctgtgccaattgatgtaggaacagaaatcaacctgtccttcagcaccaagaatgagtct
ggcatcattcttttgggaagtggaggaacaccagcaccacctaggagaaaacgaaggcag
actggacaggcctattatgcaatactcctcaacaggggccgtctggaagtacatctctcc
acaggggcacgaacaatgcggaaaattgtcgtcagaccagagccgaatctgtttcatgat
ggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaagtcgat
gaaaacagaagatatatgcaaaacctgacagttgaacagcctcttgaagttaaaaagctt
ttcgttgggggtgctccgcctgaatttcaaccttccccactcagaaatattcctcctttt
gaaggctgtgtgtggaatcttgttattaactctgtccccatggactttgcaaggcctgta
tccttcaaaaacgctgacattggtcgctgtgtccatcagaaactccgtgaagatgaagat
ggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcctttcct
acacccaccccagttctgacacatggtccttgtgctgcagaatcagaaccagctcttttg
atagggagcaagcagtttggcctttcaagaaacagtcacattgcaattgcatttgatgac
accaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaatccggc
ttgcttttttacatggctcgcatcaatcatgctgattttgccacagttcagctgagaaat
ggattgccctacttcagctatgacttggggagtggggacaccaacaccatgatccccacc
aaaatcaatgatggccagtggcacaagattaagataatgagaagtaagcaagaaggaatt
ctttatgtagatggggcctccaacagaaccattagtcccagaaaagctgacatcctggat
gttgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaagaattggt
ccagtgacctatagcattgacggctgcatcaggaatctccacatggaagaggcccctgct
gatctggaagagcccacctccagcttccatgttgggacatgttttgcaaatgctcagagg
ggaacatattttgatggaacaggttttgccaaagcagttggtggattcaaagtgggattg
gaccttctcgtagaatttgaattccgcacaactagaacgactggagttcttctagggatc
agtagtcaaaaaatggatggaatgggtattgaaatgattgatgaaaagctgatgtttcat
gtggacaatggcgccggcagattcactgctatctatgatgctggggttccagggcatttg
tgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgagctcaca
gtcgatgggaaccaggtggaagcccaaagcctaaacccagcatctacatcagctgacaca
aatgaccctgtatttgttggaggcttcccagatgacctcaagcagtttggcctgaccacc
agcattccgttccgaggttgcatcagatccctgaagctcaccaaaggcacgggcaagcca
ctggaagttaattttgccaaggccctggaactgaggggtgttcaacctgtatcatgccca
gccaactaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108535245
Entry
108535245         CDS       T04641                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108535245 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108535245 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108535245 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108535245 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108535245 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108535245 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108535245 (LAMA5)
   05145 Toxoplasmosis
    108535245 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_N Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 108535245
NCBI-ProteinID: XP_017736632
LinkDB
Position
Un
AA seq 3688 aa
MAKRLCAGSALCVRGPPGPAPLLLVGLALLGTARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CHGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPDHPL
DSPHVCRRCNCESNFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCVCKPNFRGTHCELCVPGFYGPGCQP
CQCSSPGVADDRCDPDTGQCRCREGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCPCQPGFAGPHCDQCHPGYHGFPNCQPCTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPSFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLALVDPALPEAQAPCVCRANVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDP
RGTLGGVAECQPGTGQCFCKPHVCGQACAACRDGFFGLDQADYFGCRSCRCDAGGALGQS
CEPRTGACRCRPNTQGPTCSRPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSAACANC
TAQSQPVVFPPSTEPAFVTVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSTQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLVTCTGSDVDVQLQVAVPQPGHYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
SLHPCLYSTLCRGAARDTQDRLAVFHLDSEASVRLTAEQARFYLHGVTLVPMEEFSPEFV
EPRVRCISSHGTFGPSSAACLPSRFPKPPQPIILRDCQVLPLPPGLPLTHAQDLMPATSP
TGPQPRPPTAVDPDVEPTLLHDPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQEKPLRVFGPPVSPMPTPSLLSHGYGCRYLVVLLRARPCWTPSSSSLFCRNAAAS
SPSSINNGAGHVAATKCQPQTFGCHPLVGCEECNCSGPVVQELTRGTPTCYTGQRPGKCR
PNVTGRRCDTCSPGFHGYPXCRPCDCHEAGTAPGVCDPFTGQCYCKVKCAGPRCDQCSLG
TFSLDAANPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERRPGTEM
LRADLRHVPEAVPEAFPELYWQAPPSYLGTGXAGHQVSSYGGTLRYELHSETQRGDVFVP
TESRPDVVLQGNQMSMTFLEPAHPXPGHTHRGQLQLVEGNFRHTETRNTVSREELMMVLA
SLEQLQIRALFSQISSAVSLRRVALEVASPAGQGTLASNVELCLCPASYRGDSCQVRSGQ
HQTVRRLTLPSSVFPVFPSLLPLLPVTLLTSLPTPSLCRLLADSWACPSPAAHLPAPRLP
AAHPPAPPCTHPPSSFPTCSIPHPLGHLDIPTDHPGMCPGFYRDVKGLFLGRCVPCQCHG
HSDRCLPGSGICVDCQHNTEGAQCERCQAGFVSSREDPSXPCVSCPCPLSVPSNNFAEGC
VLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLLFSDCDPLT
GACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCAPCGTEACNPHSGQCLCKAGVTG
RRCDRCREGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCRECAPGYWG
FPEQGCRRCQCPGGRCDPHTGRCTCPPGLSGERCDTCSQQHQVPVPGGPGDHSVHCEVCD
HCVVLLLDDLERTGTLLPAIREQLRGINASSVAWARLHRLNTSITDLQSQLRSPLGPRHE
TAQQLEVLEQQSTSLGQDAQQLGSQASGTRDQASRLLAGTEATLGQAKTLLAAVRAADRT
LSELMSQTGHLGLANASALSGEQLRRTLAEVERLLWEMRARDLGAPRAAAEAELAAAQRL
LARVQEQLSSLWEENQALATHTRDRLAQHEAGLMDLREALNRAVDATREAQELNSRNQER
LEEALQRKQELSRDNATLKATLHAASDTLASVFRLLHSLDQAKEELERLAASLDGARTPL
LQRMQTFSPAGSKLRLVEAAEAHAQQLDQLALNLSSIILDINQDRLTQRAIEASSAYSRI
LQAVQAAEDAAGQALQQADHTWATVVQQGLVDRARQLLTNSSALEEAVLREQRRLGLVWA
ALQGAGTQLRDVQAKKDQLEVHIQAAQAMLAMDTDETSKKIAHAKAVATEAQDMATRVQS
QLQAMQESVERWQGQYEGLRGQDLGQAVLDAGRSVSSLEKTLPQLLAKLSVLENRGAHNA
SLVLSASIGRVRQLIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYTALKFYLQD
PEPEPGQGTGDHFVMYMGSRQATGDYMGVSLRDKKVHWVYRLGEAGPAVLSIDEDIGEQF
AAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFMPP
PLLRFPGYRGCIEMDTLNEEVVSLYNFERSFQLDTAVDRPCARSKSTGDPWLTDGSYLDG
TGFARISFDGQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVREGSLVLLYDFGAGL
REAVPLQTPPPLTSASKAIQVFLLGGSRKRVLVRVERPTVLQRWSEEQCSGTGRRGLTTW
ARPPDQLPPSLRRLFPMGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLLVGRAMT
FHGHGFLHLALSNVAPLTGDVYSGFGFHSAQDSALLYYRASPDGPCQVSLRQGHVTLQLL
RTEVVAEGGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPEPQPQPEGPPSLFL
GGLPEPDTFHFSGCISNIFVRRLLGPQRVFDLQQNLGSVNVSTGCAPTLQAQTLDLGPRG
LQTAARKASRRSRQPTQDPACMLPPHLRTTRDTYQFGGSLSSHLEFVGILAPHRNWPSLS
MHVLPRSPRGLLLFAASLRPSSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRSRPGHWHK
VSVRWEKNQILLVTDGARAWSQEGPRQQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGF
SGCVKRLRLHGKPLGAPTRMAGVTPCISGPLEAGLFFPGSGGVITLDLPGATLPDVGLEL
EVRPLAVTGLIFHLGQAQTPPYLQLQVTEKQVLLRADDGAGEFSTSVARPSVLCDGQWHR
LAVMKGGNVLRLEVDAQSNHTVGPSLAAAAAAPAPLHLGGLPEPMAMQPWPPAYHGCMRR
LAVNRSPVTMTHSAEVHGAVGANGCPAI
NT seq 11067 nt   +upstreamnt  +downstreamnt
atggcgaagcggctgtgcgcggggagcgcactgtgtgtccgcggccccccgggccccgcg
ccgctactgctggtcgggctggcgctactgggcacggcgcgggcgcgggaggaggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcgccgcc
tccgcaacctgcggggaggaggccccggcgcgcggctccccgcgccccaccgaggacctt
tactgcaagctggtggggggccccgtggccggcggcgaccccaaccagaccatccagggc
cagtactgtgacatctgtacggctgcgaacagcaacaaggcacacccagcaagcaacgcc
atcgatggcacagagcgctggtggcagagcccacccctgtcccgcggcctggagtacaac
gaggtcaacgtcaccctggacctgggccaggtcttccacgtggcctacgtcctcatcaag
tttgccaactcaccccggccggacctctgggtgctggagcggtccatggacttcggccgc
acctaccagccctggcagttctttgcctcctccaagagggactgtctggagcggtttggg
ccacagactctggaacgcatcacacgggacgacgcggccatctgcaccaccgagtactcg
cgcatcgtgcccctggagaatggagagatcgtggtgtccctggtgaatgggcgcccaggc
gccatgaatttctcctactcgccgctgctgcgtgagttcaccaaggcaactaacgtccgc
ctgcgcttcctgcgcaccaacacgctgctgggccacctcatggggaaggcgctgcgagac
cccacagtcacccgccggtattattacagcatcaaggacatcagcatcggaggccgctgt
gtctgccatggccacgcggacgcctgtgatgccaaagaccccacagacccgttcaggctg
cagtgcacctgccagcacaacacctgcgggggcacctgcgaccgctgctgccctggcttc
aaccagcagccgtggaagcctgcgactgccaacagtgccaatgagtgccagtcctgtaac
tgccacggccacgccaccgactgttactacgaccctgaggtggaccggcgccgtgccagc
cagagcctggatggcacctatcagggcgggggtgtctgtatcgactgccagcaccacacc
accggcgtcaactgtgagcgctgcctgccaggcttctaccgctctcccgaccacccgctt
gactcaccccacgtctgccgccgctgcaactgcgagtccaacttcacggatggcacctgc
gaggacctgacgggtcgctgctactgccggcccaacttctctggggagcggtgcgacgtg
tgtgccgagggcttcacgggcttcccaagttgctacccgacaccctcgtcctccaatgac
accagggagcaggtgctgccagccggccagattgtgaattgtgactgcagcgcggcaggg
acccagggcaacgcctgccggaaggacccgagagtgggacgctgcgtgtgcaaacccaac
ttccgaggcacccattgtgagctctgcgtgccagggttctatggccccggctgccagccc
tgccagtgttccagccctggagtggccgatgaccgctgtgaccctgacacaggccagtgc
aggtgccgagagggcttcgagggggccacatgtgatcgctgtgcccctggctacttccac
ttccctctctgccagttgtgcggctgcagccctgcaggaaccctgcccgagggctgcgac
gaggccggccgctgcccatgccagcctgggtttgctggacctcattgtgaccagtgccac
cctggctaccacggtttccccaactgccaaccgtgcacctgcgatccccggggagccctg
gaccagctctgtggggcaggaggtttgtgccgctgccgccccggctacacaggcaccgcc
tgccaggaatgtagccccagcttccatggcttccccagctgtgtcccctgccactgctct
gctgaaggctccctgcatgcagcctgcgacccccggagtgggcaatgcagctgccggccc
cgcgtgacggggctgcggtgtgacacatgtgtgccaggtgcctacaacttcccttactgc
gaagctggctcttgccaccctgctggtctggctctggtggatcctgcccttcctgaggca
caggctccctgtgtgtgccgagctaacgtggaggggccgagctgtgaccgctgcaaacct
ggattctggggactaagccccagcaaccccgagggctgcacccgctgcagctgtgacccc
aggggcacgctgggtggagttgctgagtgccagccaggcaccggccagtgcttctgcaag
ccccacgtgtgtggccaggcctgtgcagcctgcagggatggcttctttggactggatcag
gctgactatttcggctgccgcagctgccggtgtgacgctggtggtgccttgggccagagc
tgtgaaccgaggacaggcgcctgccggtgccgccccaacacccagggccccacctgcagc
cggcctgcgagggaccactacctcccggacctgcaccacctgcgcctggagctggaggag
gccgccacacctgagggtcacgccgtgcgctttggcttcaaccccctcgagttcgagaac
ttcagctggaggggctatgcgcaaatggcacctgtccagcccaggatcgtggccaggctg
aacctgacttcccccgaccttttctggcttgtcttccgatacgtcaaccggggggccatg
agtgtgagcgggcgggtctctgtgagagaggagggcaggtcggccgcctgcgccaactgc
acagcgcagagccagcccgtggtcttcccgcccagcacagaacctgccttcgtcactgtg
ccccagaggggcttcggagagcccttcgtgctgaaccctggcacctgggccctgcttgtg
gaggctgaaggggtgctcctggactacgtggttctgctgcctagtgcgtactacgaggcg
gcactcctgcagctgcgagtgactgaggcctgcacgtaccgcccctctacccagcagtct
ggcgacaactgcctcctctacacacacctccccctggatggcttcccttcggccgctggg
ttggaggccctgtgtcgccaggacaacagcctgccccggccctgccccacagagcagctc
agcccatcgcacccaccactggtcacctgcacaggcagtgatgtggatgtccagcttcag
gtggcagtgccacagccgggccactacgccctggtggtggagtatgccaatgaggacgcc
cgccaggaggtgggcgtggccgtgcacaccccacagcgggccccccagcaggggctgctc
tccctgcacccctgcctgtacagcaccctgtgccggggcgctgcccgggatacccaggac
cgcctggccgtcttccacctggactcggaggccagcgtgaggctcacagctgaacaggca
cgcttctacctgcacggggtcactctggttcccatggaggagttcagcccggagttcgtg
gagccccgggtccgctgcatcagcagccacggaacctttggtcccagcagtgccgcctgt
ctgccctcgcgcttcccaaagccgccccagcccatcatcctcagggactgccaggtgctc
cctctgccgcccggcctcccgctgacccacgcacaggacctcatgccagccacgtcccca
actggaccccaacctcggccccccaccgccgtggaccctgatgtggagcccactttgctg
catgatccccaggccaccgtggtcttcaccacccatgtgcccacgctgggccgctatgcc
ttcttgctgcatggctaccagccagcccaccccaccttccccgtggaagtcctcatcaac
gccggccgcgtgtggcaggaaaagcccctgcgcgtctttgggcctcctgtctcgcccatg
ccaacgcccagccttctgtcacatggctacggctgccgctacctggtggtgctgctgagg
gccaggccctgctggacccccagcagctcatccctgttctgccgaaacgccgctgcctcc
tctccctcttctatcaacaacggagccggccatgtggctgccacgaagtgccagccccag
acctttggctgccaccccctggtcggctgtgaggaatgtaactgctcaggcccggtggtc
caggagctcaccagggggacccctacctgttacacaggacagcggccaggcaagtgcaga
cccaacgtgaccgggcgccgctgtgatacctgctctccgggcttccatggctaccccnac
tgccgcccctgtgactgtcatgaggcaggcactgcgcctggtgtgtgtgaccccttcaca
gggcagtgctactgtaaggtgaaatgtgcagggccccgatgtgaccagtgcagccttggg
accttctccctggatgctgccaaccccaaaggttgcacccgctgcttctgttttggggcc
acggagcgctgccggagctcgtcctacacccgccaggagttcgtggacatggagggctgg
gtgctgctgagcactgaccggcaggtggtgccccacgagcggcggccagggacggagatg
ctccgtgcagacctgaggcacgtgcccgaggctgtacctgaggccttccccgagctgtac
tggcaggccccaccctcctacctggggaccgggtaagcagggcatcaggtgtcatcctac
ggtgggaccctccgttatgaactgcactcggagacccagcggggagatgtctttgtcccc
acggagagcaggccggatgtggtgctgcagggcaaccagatgagcatgacattcctggag
ccggcacaccccntgcccggccacactcaccgtgggcagctgcagctggtggaggggaac
ttccggcacacggagactcgcaacactgtgtcccgtgaggagctcatgatggtgcttgcc
agcctggagcagctgcagatccgtgccctcttctcgcagatctcctcggctgtctccctg
cgcagggtggcactggaggtggccagcccagcaggccaggggaccctggccagcaatgtg
gagctgtgcctgtgccctgccagctaccggggggactcatgccaggtgaggtcaggacaa
caccagactgtgaggcggctcacccttccctccagcgtcttccctgtgttcccttccttg
ctgcctctacttcctgtcaccctactcacctctcttcctaccccttccctttgcaggctg
ctggccgactcatgggcctgcccgtcccctgctgcccatctgcctgcccctcgtctgcct
gctgctcatccgcctgcccctccatgcacacaccctccatcctccttccccacctgctcc
attccccacccactgggtcacctggacatccccactgaccatcctggaatgtgccccggc
ttctatcgggacgtcaaaggtctcttcctgggccgatgtgtcccttgtcagtgccacgga
cactcagaccgctgcctccctggctctggcatctgcgtggactgccagcacaacaccgaa
ggagcccaatgtgagcgctgccaggctggctttgtgagcagcagggaggaccccagcngc
ccctgtgtcagctgcccctgtcccctctcagtgccttccaacaacttcgccgagggctgt
gtcctgcgaggtggccgcacccagtgcctctgcaaacctggttatgcaggcgcctcctgt
gagcggtgcgcgcctggcttcttcgggaacccgctggtgctgggcagctcctgccagcct
tgtgactgcagcggcaatggtgaccccaacctgctcttcagcgactgcgaccccctgacg
ggcgcctgccgtggctgcctgcgtcacaccaccgggccacgctgcgagatctgtgcccct
ggcttctatggcaacgccctgctgcccggcaactgcacccggtgcgactgtgccccatgt
gggacagaggcctgcaacccccacagcgggcaatgcctgtgcaaggcgggtgtgactggg
cggcgctgtgaccgctgtcgggaaggacattttggcttcgacggctgcgggggctgccgc
ccgtgtgcttgtggaccggccgccgagggctccgagtgccacccccagagcggacagtgc
cactgccgaccagggaccatgggaccccaatgccgcgagtgtgcccctggctactggggg
ttccctgagcagggctgcaggcgctgccagtgccctgggggccgctgtgaccctcacacg
ggccgctgcacctgccccccagggctcagtggggagcgctgtgacacctgcagccagcag
catcaggtgcctgttccaggtgggcctggggaccacagcgtccactgtgaagtgtgtgac
cactgtgtggtcctgctcctggacgacctggaacggaccggcaccctcctccccgccatc
cgcgagcaactgcgtggcatcaatgccagctctgtggcctgggcccgtctgcacaggctg
aacacctccatcactgacctgcagagccagctccggagccctctggggccccgccacgag
acggcacagcagctggaggtgctggagcagcaaagcacaagcctcgggcaggatgcacag
cagctgggcagccaggcctcggggacccgagaccaagcgagccgattgctggctggcacc
gaggccacactgggccaggcgaagacgctgttggcggccgtccgggctgcggaccgcacc
ctgagcgagctcatgtcccagaccggccacctggggctggccaatgcctcggctctgtca
ggcgagcagctgcgccggacgctggccgaggtggagcggctgctctgggagatgcgggcc
cgggacctgggggccccgcgggcagccgctgaggctgagttggctgcagcgcagagattg
ctggcccgagtgcaggagcagctgagcagcctctgggaggagaaccaggcactggccaca
cacacccgtgaccggctggcccagcatgaggccggtctcatggacctgcgagaggccttg
aaccgggcagtggacgccacgcgggaggcccaggagctcaacagccgcaaccaggagcgc
ctggaggaagccctgcaaaggaagcaggagctgtcccgggacaatgccaccctgaaggcc
actctgcatgcagctagcgacaccctggccagcgtcttcagattgctgcacagcctggac
caggccaaggaggagctggagcgcctcgctgccagcctggacggggctcggaccccactg
ctgcagaggatgcagaccttctccccagcgggcagcaagctgcgtctggtggaggccgcc
gaggcccacgcacagcagctggaccagctggcgctcaacctgtccagcatcatcctggac
atcaaccaggaccgccttacccagagggccattgaggcctccagcgcgtacagccgcatc
ctgcaggccgtgcaggctgccgaggacgccgctggccaggccctgcagcaggcagaccac
acctgggcgacagtggtgcagcagggcctggtggaccgagcccggcagctcctgacaaac
agcagtgcactggaggaggccgtgctccgggagcagcggaggctgggccttgtgtgggct
gccctccagggtgccgggacccagctccgagatgtccaggccaagaaggaccaactggag
gtgcacatccaggcggcgcaggccatgcttgccatggacacagatgagacaagcaagaag
atcgcacacgccaaggctgtggccactgaagcccaggacatggccacccgtgtgcagtcc
cagctgcaggccatgcaggagagcgtggagcggtggcagggccagtacgagggcctgcgg
ggccaggacctgggccaggcggtgctcgacgcaggccgctcagtgtccagcctggagaag
acgctgccccagctgctggccaagctgagcgtcctggagaaccgtggggcccacaacgcc
agcctggtcctgtccgccagcatcggccgtgtgcggcagcttattgcccaggcccggggg
gctgccagcaaggtcaaggtgcccatgaagttcaacgggcgctcaggggtgcagctgcgc
accccacgggatcttgccgaccttgctgcctacactgccctcaagttctacctgcaggac
ccggagcctgagcctgggcagggtaccggggatcactttgtgatgtacatgggcagccgc
caggccactggggactacatgggtgtgtctctgcgtgacaagaaggtgcactgggtgtat
cggctgggtgaggcgggccctgcagtcctaagcatcgacgaggacattggggagcagttt
gcagctgtcagcctggacaggactctccagtttggccatatgtctgtcacagtggagaga
cagatgatccaggaaaccaagggtgacacggtggcccctggggcagaggggctgctcaac
ctgcggccagacgactttgtcttctacgtcgggggttaccccagtaccttcatgccccct
cccctgcttcgcttccctggctaccggggctgcatcgagatggacacgctgaacgaggag
gtggtcagcctctacaacttcgagaggtccttccagctggacacggctgtggacaggcct
tgtgcccgctccaagtcgaccggggacccgtggctcacggacggctcctacctggatggc
accggttttgcccgcatcagcttcgatggtcagatcagcaccaccaagcgcttcgaacag
gagctgcgcctcgtgtcctacagtggggtcctcttcttcctgaagcagcagagccagttc
ctgtgcttggccgtgcgagaaggcagcctcgtgctgctgtatgactttggcgccggcctg
agagaggctgtcccactgcagaccccaccgcccctgacctcagccagcaaggcgatccag
gtgttcctgctggggggcagccgcaagcgtgtgctggtgcgtgtggagcggcccacggtg
cttcagcgctggagcgaggagcaatgctctggaactggccgacggggccttactacctgg
gcgcgcccgcctgaccagctgcccccgagcctgcgacggctcttccccatgggaggctca
gtccgtggctgcgtcaaagggatcaaggccctgggcaagtatgtggacctcaagcggctg
aacacgacaggtgtgagtgccggctgcaccgctgacctgctggtggggcgtgccatgact
ttccacggccacggcttccttcacctggcactctcgaacgtggcgcccctcactggcgac
gtctactccggctttggcttccacagtgcccaggacagtgccctgctctactaccgggcg
tccccggatgggccatgccaggtgtccctgcggcagggccatgtgaccctacagctcctg
agaactgaagtggtagctgaggggggcttcgccgatggcgccccccattacgtcgccttc
tacagcaatgccacaggggtctggctctatgtcgacgaccagctccagcagatgaagccc
caccggggaccacccccagagccccagccgcagcctgaggggcccccgagtctcttcctg
ggaggcctgcctgagcctgacacctttcacttcagtggctgcataagcaacatcttcgtg
cggcggctcctgggcccacagcgtgtattcgacctgcagcagaacctgggcagcgtcaac
gtgagcacaggctgtgcacccaccctgcaagcccagaccctggacctggggcctagagga
ctgcagaccgccgcccggaaggcctcccgccgcagtcgtcagcccacccaggatcccgcc
tgcatgctgcccccacacctcaggaccacccgagacacctaccagtttgggggttccctg
tccagtcacctggagtttgtgggcatcctggccccacataggaactggcccagcctctcc
atgcacgtcctcccgcgaagcccccgtggcctcctgctcttcgctgctagcctgaggccc
agcagcccctccctggcactcttcctgagcaatggacacttcgtcgcacagatggaaggc
cttgggactcggctccgcgcccagagccgccagcgctcccggcctggccactggcacaag
gtctccgtgcgctgggagaagaaccagatcctgctggtgacggacggggcccgggcctgg
agccaggaggggccacgccagcagcaccagggggcagagcacccccagccccacaccctc
tttgtggggggcctcccggccagcagccacagctccaaacttccggtgaccgtcgggttc
agtggctgtgtgaagagactgaggctgcacgggaagcccctgggggcccccacacggatg
gcaggggtcacaccctgcatctcgggccccctggaggcgggcctgttcttcccaggcagc
gggggagttatcactttagacctcccaggagctacactgcctgacgtgggcctggaactg
gaggtgcggcccctggcagtcaccggcctgatcttccacttgggccaggcccagacaccc
ccctatttgcagctgcaggtgactgagaagcaagtcctgctgcgggcggacgatggagca
ggggagttctccacgtcagtggcccgcccctcggtgctgtgtgacggccagtggcaccgg
ctggcagtgatgaaaggcgggaacgtgctccggctggaggtggacgcacagagcaaccac
actgtgggcccctcgctggcggctgcggctgctgccccagcccctctgcaccttgggggc
ctgcctgagcccatggccatgcagccctggccccccgcctaccatggctgcatgaggagg
ctggcagtgaaccggtcccccgtcaccatgactcactctgcagaggtccacggggcagtg
ggggccaatggctgcccagccatctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536899
Entry
108536899         CDS       T04641                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha 3
  KO
K06240  laminin, alpha 3/5
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108536899 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108536899 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108536899 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108536899 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108536899 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108536899 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108536899 (LAMA3)
   05145 Toxoplasmosis
    108536899 (LAMA3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_G_2 Laminin_N Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 108536899
NCBI-ProteinID: XP_017739471
LinkDB
Position
Un
AA seq 3314 aa
MAAAARPRGRAPGPVLPPTPLLLLLLLLLLLVLPAWGATARDPGAAVGLSLHPPYFNLAE
AARIWATATCGERGPGERRPRPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPV
TNAIDGSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVD
FGSTYSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLING
RPGAKNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIG
GRCVCNGHAEVCNANNPEKLNDENIDLVCFFSACNCHGHASDCYYDSDVEWQQASLNTQG
IYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAPDGCIPCSCDPEHADGCEQGSGR
CQCKPNFHGDNCEKCAVGYYNFPFCLKIPIFPVSTPSPEDPVAGDLRGCDCNLEGVLPEI
CDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSALGSYQMPCSSVTGQCECRPGVT
GQRCDRCLSGAYDFPHCQGSSSACDPAGTIDSNLGSCPCKLHVEGPTCSICKPLYWNLDK
ENPSGCSECQCHKAGTVSGTGECRQGDGDCHCKSHVGGDSCDTCEDGYFALEKSNYFGCQ
GCQCDIGGALSSVCSGRSGVCQCREHVMGKACQRPENNYYFPDLHHMKYEIEDGSTPNGR
DLRFGFDPLAFPGFSWRGYAQMTSVQNDVRITLNVGKSSGSLFHVILRYINPGAEAVSGH
ITIYPSWGKASAAQSKEIIFLPSKEPAFVTVPGNGFADPFSITPGIWVACIKAEGVLLDY
LVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVTRFPCTLACEARHFLLDGEP
RPVAVRQPTPAHPVMVDLSGREVELHLQLRVPQVGRYVVVLEYSTEAAQLFVADVNVKSP
GSVLAGQVNIYSCKYSVLCRSAVIDHMSRIAVYELLADADIQLKGHMARFLLHQVCIIPV
EEFSAEYVRPQVHCIASYRRFVNQSATCVSLAHETPPTALILDVVSGRPFPHLPQQSSPS
VDVPPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHLTFPAQVSVDGGWPRAGSFRA
SFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSLVLVRVLMVPTENYDYQILHK
KSMDKSLEFITHCGKNSFYIDPQTASRFCKNSARSLVAFYHKGALPCECHPTGATSPHCS
PEGGQCPCRPNVIGRQCTRCATGHYGFPHCKPCSCGPRLCEEMTGQCRCPPRTVRPQCEV
CETHSFSFHPMAGCEGCNCSRRGIMEAAMPECDRDSGQCRCKPRITGRQCDRCASGFYRF
PECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCRKGSFHLDPANPKGCTSCFCF
GVNNQCHSSHKRRAKFVDMLGWRLETADRMDIPVSFNPGSNSMVADLQELPATVHSASWV
APASYLGDKVSSYGGYLTYQAKSFGLPGDMVLLEKKPDVQLTGQHMSIIYEETNTPRPDR
LHHGRVQVVEGNFRHASSRAPVSREELMTVLSRLADMRIQGLYFTETQRLTLSEVGLEEA
SDTGSGRRAYAVEMCACPPAYAGDSCQGCSPGYYRDHKGLYTGRCVPCNCNGHSNRCQDG
SGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNRFATGCVVNGGDVRCSCKA
GYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGQLGSCDPLTGDCINQEPKDSSPAEEC
DDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAELLEQMRHVETQAKDLRNQLLNYRS
AISNHGSKIEGLERELTGLNQEFETLQEKAQVNSRKAQTLYNNVNRAIQSAKELDMKIKT
VIRNVHILLKQISGTDGEGNNVPSGDFSREWAEAQRMMRELRNRNFGKHLREAEADKRES
QLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAARAKQANGLNQEN
ERALGAIQRQVKEINSLQSDFTKYLTSADSSLLQTNIALQLMEKSQKEYEKLAASLNEAR
QELSDKVRELSRSAGKTSLVEEAEKHAQSLQELAKQLEEIKRNASGDELVRCAVDAATAY
ENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLSSNSDKLLNEAKMTQKKLKQ
EVHPALSNLQQTLNIVTVQKEVIATNLTTLRDGLRGIQRGDIDAMISSAKSMVRKANDIT
DEVLDGLNPIQTDVERIKDTYGSTQTEDFKKALTDADNSVNKLTNKLPDLWRKIESINQQ
LLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLF
LQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLTCVYNLGDRETELQVDQILTE
SETQEAVMDRVKFQRIYQFARLNYTKGATSSKPEIPGVYDMDGRNSNTLLNLDPENVVFY
VGGYPPDFKLPSRLRFPPYKGCIELDDLNENVLSLYNFKKTFNLNTTEVEPCRRRKEESD
KNYFEGTGYARVPTQPHASIPTFGQTIQTTVDRGLLFFTENGDRFISLNIEDGKLMVRYK
LNSEPPKERGVGDAINNGRDHSIQIKIGKVQKRMWINVDFQNTIIDGEVFDFSTYYLGGI
PIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQLS
FTNLGSPLTDHLQASFGFQTFQPSGVLLSLQTRTSTLQVTLEDGHIELSTRDSDGPISKS
PQTYMDGLLHYVSVISDNSGLRLLIDDQPLRNGQRPKRISSSQQSLRLGGSNFEGCISNV
FVQRLSLSPEVLDLASNSLKRDVSLGGCSLNKPPFLMLLQGSTRFNKAKTFRINQLLQDT
PVASPRSMKVWQDACSPLPRTQANHGALQFGDIPTSHLLFKLPQELLKPRSQFAVDMQTT
SSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLRIKSKEKCNDGKWHTVVFGHDGEK
GRLVVDGLRAREGSLPGNSTVSIRGPVYLGSPPSGKPKSLPTNSFVGCLKNFQLDSKPLD
TPSSSFRVSSCLGGPLEKGIYFSEEGGHVILAHSVLLGPEFKLVFSIRPRSLTGILIHIG
SQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDGQWHSVAVTIKQHILHLELDT
DSSYTAGQIPFPPASTQEPLHLGGAPDNLTTLRIPVWKSFFGCLRNIFVNHIPVPVTEAL
EVQGPVSLNGCPDH
NT seq 9945 nt   +upstreamnt  +downstreamnt
atggcggcggccgcgcggcctcggggtcgggcaccggggccagtcctgccgccgacgccg
ctgctgctgctgctgctgctgctgctgctgctagtgctgccagcctggggggcgaccgct
cgggatcccggggccgcggtcgggctcagccttcaccctccttacttcaacctggccgag
gcagcgaggatttgggccaccgccacctgcggggagaggggacccggcgagaggaggccc
cggcccgagctctactgcaagttggtcgggggccccaccgccccaggcagcggccacacc
atccagggccagttctgtgactattgcaattctgaggaccccaggaaagcacatcctgtc
accaatgccattgatggatctgaacgttggtggcaaagccctcccctgtcctcaggcaca
cagtacaacagagtcaacctcaccttggatctggggcagctcttccatgtggcctacatt
ttaatcaaatttgcaaattctcctcgccctgatctttgggtcttggaaagatctgtagat
tttggaagcacctactcaccatggcaatactttgctcattctaaagtagactgtttaaaa
gaattcgggcgggaggcaaatatggctgtcacccgggatgatgatgtactttgtgttact
gaatattcccgtattgtacctttggaaaatggtgaggttgtggtgtccttgataaacggt
cgtccaggtgcaaaaaattttactttctctcacaccctgagggagtttaccaaggcaaca
aacatccgcttgcgttttcttcgaaccaatacgcttcttggacacctcatctccaaagcc
cagcgagatccaactgtcactcggcggtattattacagcataaaggacatcagcattggt
gggcggtgtgtttgcaatggccatgctgaagtgtgcaatgcaaacaatcctgaaaaactt
aatgatgagaatattgacttagtatgctttttttcagcatgcaactgccacggccatgcc
agtgattgttactatgattcagatgttgagtggcagcaggcaagcttgaatacccagggc
atctatgctggtggaggggtctgcattaactgtcagcacaacacagcgggagtaaactgt
gaacagtgtgctaagggctattaccgcccttatggggttccagtggatgcccctgatggc
tgcatcccctgcagctgtgaccctgagcatgcggatggctgtgaacagggctcaggccgc
tgtcagtgcaagccaaatttccatggagacaactgtgagaagtgtgcagttggatactac
aattttccattttgcttgaaaattcccatttttcctgtttctactccaagtccagaagat
ccagtagctggagatctaagagggtgtgactgtaatctggaaggtgttctccccgaaata
tgtgatgcccacggacggtgcctgtgccgccctggggttgagggccctcgatgtgatacc
tgccgttctggtttctactcgttccctatttgccaagcctgctggtgttcggcccttgga
tcctaccagatgccctgcagctcagtgactggacagtgtgaatgtcggccaggagttaca
ggacagcggtgtgacaggtgtctctcaggagcctatgatttcccccactgccaaggttcc
agcagtgcttgtgacccagctggtactatcgactccaatttggggtcttgcccatgcaag
cttcacgttgaaggccctacttgcagcatctgcaaaccgttgtattggaatctggacaaa
gaaaaccccagtggatgttcagaatgccagtgccataaggcgggaacagtgagtggaact
ggagagtgtaggcagggagatggtgactgtcactgcaagtcccatgtgggtggcgattcc
tgcgacacctgtgaagatggatattttgctttggaaaagagcaattactttgggtgtcaa
gggtgccagtgtgacattggtggggcgttgtcctctgtgtgcagcgggcgctccggagtg
tgccagtgccgagagcatgtcatgggaaaggcgtgccagcggcctgaaaacaactactat
ttcccagatttgcatcatatgaagtacgagattgaagacggcagcacacctaatgggaga
gaccttcggtttggatttgatccgctggcatttcctgggtttagctggagaggatatgcc
caaatgacctcagtacagaatgatgtaagaataacattgaatgtggggaagtcaagtggc
tccttgtttcacgttattctgagatacattaaccctggagctgaagcagtatctggccat
ataactatttatccatcctggggtaaggcaagtgctgctcaaagcaaagagatcatcttc
ctaccaagtaaggagccagcctttgtcaccgtccctggaaatggttttgcagacccattt
tcaatcacaccaggaatatgggttgcttgtattaaggcagaaggagtccttctggattac
ctggtactgctccccagggactactatgaagcctctgtactacagctgccagtcacagaa
ccatgtgcttacgcaggacctccccaagaaaattgcttgctctaccagcatttgccagtg
accagattcccctgtaccttggcttgtgaggccagacacttcttgcttgatggggagccc
agacccgtggcagtgaggcagcccacacctgcacaccctgtcatggtggacctcagcggg
agagaggtggaattacatctgcagctgcgcgtcccacaggttggccgctacgtggttgtg
cttgagtattctacagaggcagcccagctgtttgtggctgatgtgaacgtgaagagcccc
gggtctgttctggcaggccaggtgaacatttacagctgcaagtacagcgttctctgccgg
agcgctgtgattgatcacatgagccgcatcgctgtgtatgagctattggcagatgcagac
attcagctcaagggacacatggcccgattccttctgcatcaagtttgtatcatacccgtt
gaagaattctcagctgagtatgtgagaccgcaagtccactgcattgccagttacaggcga
tttgtcaatcaaagtgccacctgtgtctccctggcccatgaaactcctccaacagcatta
attttggatgttgtaagtggcaggcctttccctcacctgccccagcagtcttcgccttct
gttgatgttcctcctggggtcaccttgaaggcaccgcagaatcaagtgaccctgagagga
cgtgtaccacacctgggccgatacgtctttgtcatccatttttatcaagcagcgcacctg
acgtttcccgcgcaggtgtcagtggacggcgggtggccacgggcaggctccttccgtgcc
tctttttgcccccatgtgcttggctgccgggatcaagtgattgccgaaggccagattgag
tttgacatctcagagcctgaagtggctgcaaccgtgaaggttccagaaggaaagtccttg
gttttggtccgtgttctaatggtgcctacagaaaactatgactaccaaatacttcacaaa
aaatccatggacaagtcacttgagtttatcacccattgtggaaaaaacagcttttacatt
gacccccagacagcctccagattctgtaagaattctgccaggtccctggtggccttttac
cacaaaggcgccctgccttgtgagtgccaccccaccggggccaccagccctcactgcagc
cctgaaggtgggcagtgcccatgccggcccaacgtcattgggcggcagtgcacccgctgt
gcaacaggccactatggattcccacactgcaagccgtgcagctgtggcccacgcctttgt
gaagagatgacagggcagtgccgttgccctccccgcacggtcaggccccagtgcgaagtg
tgtgagacacactcgttcagcttccaccccatggccggctgcgaaggctgcaactgttcc
aggaggggcatcatggaggctgccatgccagagtgtgaccgggacagcgggcagtgcaga
tgcaagcccagaatcacagggcggcagtgtgaccgatgtgcttccgggttttaccgattc
cctgagtgtgttccctgcaattgcaaccgagatgggactgagccaggggtgtgtgaccca
gggaccggggcttgcctctgcaaggaaaatgtagaaggcacagagtgtaatgtgtgtcga
aaaggctcattccatttggacccagccaatcccaagggttgtaccagctgtttctgtttt
ggagtaaataatcaatgtcacagctcacataagcgaagggctaagtttgtggatatgctg
ggctggcgcctggagacggcagacagaatggacatccccgtctcattcaacccgggcagc
aacagcatggtggcggatctccaggagctgcccgcaactgtccacagcgcgtcctgggtc
gcacccgcgtcctacttgggggacaaggtttcttcatatggtggctacctcacttaccaa
gccaagtccttcggcttgcctggcgacatggttcttctggaaaagaagccggatgtacag
ctcactggtcagcacatgtccatcatctatgaggagacaaacaccccacggccagaccgg
ctgcatcacgggcgagtgcaggtggtcgagggaaacttcagacatgccagcagccgtgcc
ccggtgtctagggaggagctgatgacagtgctgtctagactggcagatatgcgcatccaa
ggcctgtacttcacagagactcaaaggctcaccctgagtgaggtggggctggaggaagcc
tctgacacaggaagtggacgcagagcatatgctgtggaaatgtgtgcctgcccccctgcc
tacgctggcgactcttgtcagggttgtagccctggatattatcgggatcacaaaggcttg
tataccggacggtgtgttccctgcaattgcaacggacattcaaatcgatgccaggatggc
tcaggcatatgtgttaactgtcagcacaacaccgcgggggagcattgtgaacgctgccag
gagggctactatggcaacgccgtccacggatcctgcagggcctgcccgtgtcctcacacc
aacaggtttgccaccggctgtgtggtgaacgggggagacgtgcggtgctcctgcaaagct
gggtacacaggaacacagtgtgaaaggtgtgcaccgggatatttcgggaatccccagaaa
ttcggaggtagctgccaaccatgcagttgtaacagcaatggccagctgggcagttgtgat
cccctgactggagactgcataaaccaagaacccaaagatagcagccctgcagaagaatgt
gatgattgcgacagctgtgtgatgaccctcctgaatgacctggccaccatgggcgagcag
ctccgcctggtcaagtctcagctgcagggcctgagtgccagcgcggagcttctggagcag
atgaggcacgtggagacccaggccaaggacctgaggaatcagttgctcaactaccgttct
gccatttcaaatcatggatcaaaaatagaaggcctggaaagagaactgactggtctgaat
caggaatttgagactttgcaagaaaaggctcaagtaaattccagaaaagcacaaacatta
tacaacaatgttaatcgggcgatacaaagcgcaaaagaactggatatgaagattaaaact
gtcatccggaatgtgcacattctcttaaagcagatctcggggacagatggagagggaaac
aacgtgccttcaggtgacttttccagagagtgggccgaagcccagcgcatgatgagggaa
ctgcggaacaggaactttggaaagcacctgagagaagcagaagctgataaaagggagtca
cagctcttgctgaaccggataaggacctggcagaaaacccaccagggggagaacaacggg
cttgctaatagtatacgggattctttaaatgaatacgaagccaaactcagtgaccttcgt
gctcggctgcaggaggcagctgcccgagccaagcaggcaaatggcttgaaccaagaaaat
gagagagctttgggagccatccagagacaagtaaaagaaataaattccctgcagagtgat
ttcaccaagtatctaacctctgcagactcatctttgttgcaaaccaacattgcactgcag
ctgatggagaaaagccagaaggaatatgaaaaattagctgccagtttaaatgaagcaaga
caagaactaagtgacaaagtaagagaactttccagatctgctggcaaaacatcccttgtg
gaggaggcagaaaagcacgcgcagtccttacaagagctggcaaagcagctggaagagatc
aagagaaatgccagcggggatgagctggtgcgctgtgctgtggatgccgccaccgcctat
gagaacatcctcaacgccatcaaagcggccgaggacgcggccaacagggctgccagtgca
tctgaatctgccctccagacagtgataaaggaagatctgccaagaaaagctaaaaccctg
agttccaacagtgataaactgttaaatgaagccaagatgacacaaaagaagctaaagcaa
gaagtccatccggctctcagcaacctacagcaaaccctgaatattgtgacagttcagaaa
gaagtgatagccaccaatcttacaactctccgagatggtcttcgtgggatacagagaggt
gatattgatgctatgatcagtagtgcaaagagcatggtcagaaaggccaacgacatcaca
gatgaggtcctggatgggctcaaccccattcagacagatgtggaaagaattaaggacacc
tatgggagcacacagaccgaagacttcaaaaaggctctgactgatgcagataactcggtg
aataagttaaccaacaaactacctgatctttggcgcaagattgaaagtatcaaccaacag
ctgttgcccttgggaaacatctctgacaacatggacagaatacgagaattaattcagcag
gccagagatgctgccagtaaggttgctgtccccatgagattcaatggtaaatctggagtt
gaagtccgactgccaaatgacctggaagatttgaaaggatacacatctctgtccttgttt
ctccaaaggcccaactcaagagaaaatgggggtactgagaatatgtttgtgatgtacctt
ggaaataaagatgcctcccgggactacattggcatggcagttgtggatggtcagctcacc
tgtgtctacaacctgggggaccgtgagactgaactccaagtggaccagatcttgaccgag
agtgagactcaggaggcagttatggatcgggtgaaatttcagagaatttatcagtttgca
aggcttaattacaccaaaggagccacatccagtaaaccagaaatacccggagtctatgac
atggatggtagaaacagcaatacgctccttaatttggatcctgaaaatgttgtattttat
gttggaggttacccacctgattttaaacttcccagtcgactaaggttccctccatacaaa
ggttgtattgaattagatgacctcaatgaaaatgttctgagcttatacaacttcaaaaaa
acattcaatctcaacacaactgaagtggagccttgtagaaggaggaaggaagagtcagac
aaaaattattttgaaggtacgggctatgctcgagttccaactcaaccacatgcttccatc
ccaacctttggacagacaattcagaccactgtggatagaggcttgctgttcttcacagaa
aacggggatcgcttcatatctctgaatatagaagatggcaagctcatggtgagatacaaa
ctgaattcagagccaccaaaagagagaggagttggagacgccataaacaacggcagagat
cattcgattcagatcaaaattggaaaagtccaaaagcgtatgtggataaatgtggacttt
caaaacactataattgatggtgaagtatttgatttcagcacatattatctgggaggaatt
ccaattgcaatcagggaaagatttaacatttctacgcctgctttccgaggctgcatgaaa
aatttgaagaaaaccagtggtgtcgttagattgaacgatactgtgggagtaaccaaaaag
tgctcggaagactggaagcttgtgcgatctgcctcattctccagaggaggacaattgagt
ttcactaatttgggctcaccgcttactgaccacctccaggcctcatttggatttcagact
tttcaacccagtggcgtattattaagtcttcagacacggacaagcaccctgcaggtcact
ctggaagatggtcacattgaattgagcaccagggatagcgacggcccaatttctaaatct
ccacaaacatatatggatggtttgctgcactatgtatctgtaataagcgacaactctgga
ctacggcttctcattgatgaccagcctctgagaaatggccaaaggccaaaacgcatttca
agttcccagcagtctctgcgtctgggcgggagcaattttgagggttgtatcagcaatgtt
tttgtccagaggttatcactgagtcccgaagtcctagatttggccagtaactctctcaag
agagatgtgtccctgggaggctgcagtttaaacaaaccaccttttctaatgttgcttcag
ggttctaccaggtttaacaaggccaagactttccgtatcaatcagctgttgcaggacaca
ccagtggcctccccaaggagcatgaaagtgtggcaagatgcctgttcaccacttcccagg
acccaggccaatcatggagccctccagtttggggacattcccaccagccacttgctattc
aagcttcctcaggagctgctgaaacccaggtcacagtttgctgtggacatgcagacaaca
tcctccagaggactggtgtttcacacgggcactaagaactcctttatggctctttatctt
tcaaaaggacgtctggtctttgcactggggacagatgggaaaaaattgaggatcaaaagc
aaggagaaatgcaatgatgggaagtggcacacggtggtgtttggccatgatggagaaaag
gggcgcttggttgtggatggactgagagcccgggagggaagtttgcctggaaactccacc
gtcagcatcagaggaccagtttacctgggatcgcctccatcagggaaaccaaagagcctt
cccacaaacagctttgtgggatgcttgaagaactttcagctggattcaaaacccttggat
accccttcttcaagcttcagggtgtcttcttgcttgggtggtcctttggagaaaggcatt
tatttctccgaagaaggaggtcatgtcatcttggctcactctgtgttgctggggccagaa
tttaagcttgttttcagcatccgcccaagaagtctcactgggatcctaatacacatcgga
agtcagcctgggaagcacttatgtgtttacctggaggccggaaaggtcacggcctctatg
gacagtggggcaggcgggacctcgacctcagtcacaccaaagcagtctctgtgtgatgga
cagtggcactcggtggcagtcaccataaaacaacacatcctgcacctggaactggacaca
gacagtagctacacagctggacagatccccttcccacctgccagcactcaagagccacta
caccttggaggtgctccagacaatttgacgacactgaggatccctgtgtggaaatcattc
tttggctgtctgaggaatatttttgtcaaccacatccctgtccctgtcactgaagccttg
gaagtccaggggcctgtcagtctgaatggctgtcctgaccactaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538728
Entry
108538728         CDS       T04641                                 

Gene name
COL4A3
Definition
(RefSeq) collagen type IV alpha 3 chain
  KO
K06237  collagen type IV alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04974  Protein digestion and absorption
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108538728 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108538728 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108538728 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108538728 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    108538728 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538728 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108538728 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108538728 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108538728 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108538728 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108538728 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108538728 (COL4A3)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108538728 (COL4A3)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108538728 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 108538728
NCBI-ProteinID: XP_017742448
UniProt: A0A2K6M2N7
LinkDB
Position
Un
AA seq 1644 aa
MSPRTAPRSQVLLLQLLLVLLAAPPTASKGCVCKDKGQCFCDKAKGEKGERGFPGPPGSP
GQKGFTGPEGLLGPQGPKGSPGLPGLTGPKGVRGVTGLPGFSGSPGLPGTPGNTGPYGLV
GVPGCNGSKGEQGFPGLPGTLGYRGIPGAPGLKGQKGLPGPPGFPGPVGPPGPPGFFGFP
GAMGPRGPKGHMGERVIGQKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGA
IGQPGPPGPSGLPGESYGSEKGAPGDPGPQGKPGKDGVPGFPGSEGVKGNRGFPGLAGED
GIKGQKGDTGPPGFRGPTEYYDTYQEKGDEGIPGPPGPKGGRGPQGPSGPPGVPGSPGSS
RPGLRGAPGWPGLKGSKGERGYPGKEAMGTPGSPGCPGSPGPPGSPGPPGPPGDIIFRKG
PPGDRGLPGYLGSSGIPGIDGPKGEPGLLCIQCPYIPGPPGLPGLPGLHGVKGIPGRQGA
AGLKGSPGSPGNTGLPGIPGFPGAEGDRGLKGEKGETPQPEGQVGAPGDPGLRGQPGRKG
FDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPGP
QGIQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGMPGSMGKCGDPG
LPGPDGEPGIPGIGFPGRPGPKGDQGFPGTKGSLGCPGKIGEPGLPGKPGVPGAKGEPAV
AMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGEQGPP
GRCIEGPRGAQGLPGLNGLKGQQGRRGKMGPKGDPGIPGLDRSGFPGETGSPGMSGHQGE
MGPPGQKGYPGNPGLLGPPGEDGVVGMMGFPGATGPPGPPGNPGMPGQRGSLGIPGVKGQ
RGTPGAKGEQGDKGNPGPSQISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGL
PGPAGPPGPRGDLGSIGNPGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGI
HGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGEMGKKGEMGQPGPPGHSGPAGPEGAHGSP
GSPGLPGKPGPHGDLGFKGIKGFPGPPGIKGPSGLPGFPGSPGPMGVRGDQGRDGIPGPA
GEKGEMGLSGAPPGPRGNPGAQGAKGDRGSPGFPGLPGRKGAMGDAGPRGPTGIEGFPGP
PGLPGAIIPGQKGNHGPPGLRGSPGEPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTVG
DMGPPGHLGAPGTPGLPGLRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPIGPPGIRG
DPGTLRIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPGSPGPAG
EKGNKGSKGEPGPPGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTAP
LYSGFSFLFVQGNERAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTP
ALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMF
TSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPI
PSTVKAGELEKIISRCQVCMKKGH
NT seq 4935 nt   +upstreamnt  +downstreamnt
atgagcccccggacggcgcccagatcgcaggtgctcctgctgcagctcctgctggtgctc
ctggccgcgccgcccacggccagcaagggctgtgtctgtaaagacaaaggccagtgcttc
tgtgacaaggccaaaggggagaagggggagagaggctttcctgggccccctggttctccc
ggccagaaaggattcacaggtcctgaaggcttgcttggaccacagggacccaagggctct
ccaggacttccaggactcacgggtcccaaaggtgtaaggggagtaactggattgccagga
ttttctggttctcctggacttccaggcaccccaggcaatactgggccttatggacttgtc
ggtgtaccaggatgcaatggttctaagggtgagcaggggtttccaggactcccagggaca
ctgggctaccgagggatcccgggtgctcctggtttgaaaggacaaaagggtttgccaggc
cctccaggttttcctgggcctgttggcccacctggtcctccgggattctttggctttcca
ggagccatgggacctagaggacctaagggtcacatgggtgaaagagtgataggacaaaaa
ggagagcggggtgtgaaagggttaacaggacccccgggaccaccaggaacagttattgtg
accctaactggcccagataacagaacggacctcaagggggaaaagggagacaagggagcc
atcggccagcctggacctcctggaccctcaggactgcctggagaatcatatggatctgaa
aagggtgctcctggagaccccggcccgcagggaaaacccggtaaagacggcgttcctggc
ttccctggaagtgagggagtcaagggcaacaggggtttccctgggttagcaggtgaagat
ggcattaagggacagaaaggggacactggccctccaggatttcgtggtccaacagaatat
tacgacacataccaggaaaagggagatgaaggcattccaggcccaccagggcccaaagga
ggtcgtggcccacaaggtcccagtggtccccccggagttcctggaagtcctggatcctca
aggcctggcctcagaggagcccctggatggccaggcttgaaaggaagtaaaggggaacga
ggctacccaggaaaggaagccatggggactcctgggtccccaggttgtcctggttcacca
ggccctccaggatcaccgggacctccaggaccaccaggtgacatcatttttcgcaagggt
ccacctggagatcgcggactgccaggctatctagggtcttcaggaatcccaggcattgat
gggcccaaaggagaaccaggcctgctgtgtatacagtgcccttatatcccagggcccccc
ggtctcccaggattgccagggttacatggtgtaaaaggaatcccaggaagacaaggtgca
gctggcttgaaaggaagcccagggtccccaggaaatacaggacttccaggaattccaggt
ttcccaggtgccgagggtgaccgaggacttaaaggagaaaaaggtgaaacacctcagcct
gaggggcaagttggtgccccaggggacccggggctcagaggtcaacctgggagaaagggc
ttcgatggaattcctggaactccgggagtgaaaggattaccaggacctaaaggcgaactg
gctctgagtggtgagaagggggaccaaggtcctccaggggatcctggctcccctgggtcc
ccaggacctgcaggaccagctggaccacctggctacggaccccaaggagaacctggtccc
cagggcatacaaggagttcctggagcccctggaccacctggagaagccggtcctagggga
gaactcagtgtttcaacaccagttccaggcccaccaggacctccagggccccctggccat
cctggcccccaaggtccacctggtatgcctggatctatggggaaatgtggagatcctggt
cttccaggacctgatggtgaaccaggaattccgggaattggatttcctgggcgtcctgga
cctaagggagaccaaggttttccgggtacaaaaggatcactgggttgtcctggaaaaata
ggagagcctgggttacctggaaagccaggcgtcccaggagccaagggagaaccagcagta
gccatgcctggaggaccaggaacaccaggttttccaggagaaagaggcaattctggagaa
catggagaaattggactccctggacttccgggtctccctggaactccaggaaatgaaggg
cttgatggaccacgaggagatccagggcagcctggaccacccggagaacaaggaccccca
ggaaggtgcatagagggtcctaggggagcccaaggacttccaggcttaaatggattgaaa
gggcaacaaggcagaagaggtaaaatggggccaaagggagacccaggaattccaggcttg
gatagatcaggatttcctggagaaactggatcaccaggaatgtcaggtcatcaaggcgag
atgggaccaccaggtcaaaaaggatatccaggaaatccaggacttttagggccaccaggt
gaagatggagtggttgggatgatgggctttcctggagccactggccctccggggccccct
gggaacccaggcatgccagggcagagggggagccttggaattccaggagtaaagggccag
agaggaaccccaggagccaagggggaacaaggagataaaggaaaccccgggccttctcag
atatcccacgtaataggggacaaaggagaaccaggtctcaaaggattcgcaggaaatcca
ggtgagaaaggaaacagaggtgttccagggatgccaggtttaaaaggcctcaaaggacta
cctggaccagcaggaccaccaggccccagaggagatttgggcagcattgggaatcctgga
gaaccaggactacgtggtataccaggaagcatggggaacatgggcatgccaggttctaaa
ggaaaaaggggaactttgggattcccaggtcgagcaggaagaccaggcctcccaggtatt
cacggtctccagggagataaaggagagccaggttattcagaaggtacaaggccaggacca
ccgggaccaacgggggatccaggactgccgggtgaaatgggaaagaaaggagaaatgggg
caacctggcccacctggacattcggggcctgctggacctgagggagcccatggaagtcct
ggaagtcctggcctcccaggaaagccaggtcctcatggtgatttgggttttaaaggaatc
aaaggcttcccgggccctccaggaatcaaaggcccttcaggtcttccaggattcccaggg
tctcctggaccaatgggtgtaagaggtgaccaaggacgtgatggaattcctggtccagcc
ggagaaaagggagaaatgggtttatcgggggcccctccaggcccaagagggaacccgggt
gctcaaggagctaaaggagacaggggatccccaggttttcctggcctccctggcagaaaa
ggggccatgggagatgctgggcctcgagggcccacaggcatagaaggattcccagggcca
ccaggtctgcccggtgcaattatccctggccagaaaggaaatcatggtccaccaggctta
agaggaagcccaggtgagcctggtccccctggacctccagggagtcacgtaataggcata
aaaggagacaaagggtctatgggccaccctggcccaaaaggtccacctggaactgtagga
gacatgggaccaccaggtcatctgggagcaccaggtactccaggtcttccaggactcaga
ggtgatcctggattccaggggtttccgggcgtgaaaggagaaaagggtaatcctggattt
ctaggatccattggacctccaggaccaattgggccaataggaccacctggtatacgtgga
gaccctggcacacttaggattatctcccttccaggaagcccagggccacctggcacacct
ggagaaccagggatgcagggcgaacctgggccaccagggccacctggaaacctaggaccc
tgtgggccaagaggtaagccaggcaaggatggaaaaccaggaagtcctggaccagctgga
gaaaaaggcaacaaaggttctaaaggagagccaggaccacctggatcagatggattgcca
ggtttgaaaggaaaacgtggagacagtggatcacctgcaacctggacaacgagaggcttt
gtcttcacccgacacagtcaaaccacagcaatcccttcatgtccagaggggacagcgcca
ctctacagtgggttttcttttctttttgtacaagggaatgaacgagcccacggacaagac
ctcggaactctgggcagctgcctgcagcgatttaccacaatgccgttcttattctgcaat
gtcaatgatgtatgtaatttcgcatctcgaaatgattattcatactggctgtcaacacca
gctctgatgccaatgaacatggctcccattactggcagggcccttgagccttatataagc
agatgcactgtttgtgaaggtcctgcgatcgccatagccgttcacagccaaaccactgac
attcctccatgtcctcatggctggatttctctctggaaaggattttcattcatcatgttc
acaagtgcaggttctgagggcaccgggcaagcactggcctcccctggctcctgcctggaa
gaattccgagccagcccatttctagaatgtcatggaagaggaacgtgcaactactattca
aattcctacagtttctggctggcttcattaaacccagaaagaatgttcagaaagcctatt
ccatcaactgtgaaagctggagaattagaaaaaataataagtcgctgtcaggtgtgcatg
aagaaaggacactaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538749
Entry
108538749         CDS       T04641                                 

Gene name
COL4A4
Definition
(RefSeq) collagen type IV alpha 4 chain
  KO
K06237  collagen type IV alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04974  Protein digestion and absorption
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108538749 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108538749 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108538749 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108538749 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    108538749 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108538749 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108538749 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108538749 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108538749 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108538749 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108538749 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108538749 (COL4A4)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108538749 (COL4A4)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108538749 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 108538749
NCBI-ProteinID: XP_017742502
UniProt: A0A2K6KPN1
LinkDB
Position
Un
AA seq 1690 aa
MSSLHVVLMRCSFRLTKSLATGPWSLILILFSVQYVYGSGKKYVGPCGGRDCSVCRCVPE
KGSRGPPGPPGPQGPIGPLGAPGPTGLSGEKGMRGDRGPPGTAGDKGDKGPTGVPGFPGL
DGIPGHPGPPGPRGKPGKCGYNGSRGDPGFPGGRGALGPGGPPGHPGEKGEKGNSVFILG
AIKGIQGDRGDPGLPGLPGSWGAGGPAGPTGYPGEPGLVGPPGQPGLPGLKGNPGVGVKG
QMGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMIGLPGPPGRKGESGIGAKGE
KGIPGFPGPWGDPGSYGSPGFPGLKGELGLVGDPGLFGFLGPKGDPGDRGHPGPPGVLVT
PPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPG
EAGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSVTYCSVGNPGPQGIKGKVGPPGGR
GSKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGL
PGKPGASGPPGNKGAKGDVVISRVKGHKGERGPDGPPGFPGQPGSHGLDGHAGEKGDPGL
PGDHEDAIPGDKGFPGPLGPPGKAGPVGPPGLGFPGPPGERGHPGVPGCPGVRGPDGLKG
QKGDTISCNVTYPGRQGPPGFDGPPGPKGFPGPPGAPGLSGSDGHKGRPGTPGTSEIPGP
PGFRGDIGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGPPGRRGLSGVPG
IKGPRGDPGYPGAEGPAGIPGFPGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPG
LPGDPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPG
PPGPKGPRGLPGFPGFPGERGKPGAEGCPGTKGEPGEKGTSGFPGDQGVRGAKGAIGPPG
DEGEMAIISKKGKPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGEPGEK
GQPGPSGHPGPPGSTGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGATGPKGNKGDPASH
FGPPGPKGEPGSSGCPGHFGASGDQGLPGVQGPRGSPGRPGPPGSSGPPGCPGDQGMPGL
RGQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPP
GPVGMPGLKGERGDPGSPGISPPGPCGEKGLPGPPGRSGPPGPAGATGRAPKDIPDPGPS
GDQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGLPGPPGPPGYKGFPGCDGK
DGQKGPMGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGPRGEPGPLADADDCPRIPG
LPGVPGLRGPEGAMGLPGMRGPPGPGCKGEPGLDGRRGMDGIPGSPGPPGRKGDTGEDGY
PGGPGPPGPTGDPGPKGFGAGYLSGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQE
KAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIR
PYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPG
SCLEDFRAAPFLECQGRQGTCHFFANEYSFWLTTVKADLQFSPAPAPDTLKESQAQRQKI
SRCQVCVKYS
NT seq 5073 nt   +upstreamnt  +downstreamnt
atgtcgtctctgcatgtagtactaatgaggtgctccttcagattgaccaagtcattggcc
acaggtccctggtcacttatactcattctcttttctgtacaatatgtatatgggagtgga
aagaaatacgttggtccttgtggaggaagagattgctctgtttgccgctgcgttcctgaa
aaggggtctcggggtccaccaggaccaccagggccacagggtccaattgggcccctggga
gccccaggacccactgggctttcaggagagaaaggaatgagaggggaccgcggccctcct
ggaacagcaggggacaaaggagataagggtccaactggtgttcctggatttccaggttta
gatggcatacctgggcacccagggcctcctggacccagaggcaaacctggtaagtgtggc
tacaatggctcaagaggtgacccagggtttccaggaggaagaggagctcttggtccagga
ggccccccaggccatcctggggaaaagggagaaaaaggaaattcagtgttcattttaggt
gccattaaaggtattcagggagacagaggcgacccaggactgcctggcttaccaggatct
tggggtgcaggaggaccggcaggccccacaggatatcctggagagccagggttagtggga
cctccgggccaaccagggcttccaggtttgaagggaaatcccggtgtgggagtaaagggg
caaatgggagacccgggtgaggttggtcagcaaggttctcctggacccaccctgttggta
gagccacctgacttttgtctctataaaggagaaaagggcataaaaggaattcctggaatg
attggactgccaggaccaccaggacgcaagggagaatctggtatcggggcaaaaggagaa
aaaggcatccctggatttccagggccttggggggatcctggttcctatggatctccaggt
ttcccaggattaaagggagaactaggactggttggagatcctggtctatttggatttctt
ggcccaaagggggatcctggagaccgagggcacccaggaccaccaggtgttttggtgact
ccacctcttccactcaaaggcccaccaggggacccaggattccctggccgctatggagaa
acaggggatgttggaccacctggtcccccaggtctcttgggcagaccaggggaagcctgt
gcaggcatgataggtccccctgggccacaaggatttcctggtcttcctgggcttccagga
gaagctggtattcctgggagacctgattctgctccaggaaaaccagggaagccaggatca
cctggcttgcctggagcaccaggcctgcagggcctcccaggatcaagtgtgacatactgt
agtgttgggaaccctggaccacaaggaataaaaggcaaagtgggtcccccaggaggaaga
ggctcaaaaggagaaaaaggaaatgaaggactctgtgcctgtgagcctggtcccatgggc
ccccctggacctccaggacttcccgggaggcaggggagtaagggagacttggggctccct
ggctggcttggaacaaaaggtgacccaggacctcctggtgctgaaggacctccagggcta
ccaggaaagcctggtgcctccggaccacccggcaacaaaggggcgaagggtgacgtggtc
atatcaagagttaaagggcacaaaggagaaagaggtcctgatgggcccccaggatttcca
gggcagccaggatcacatggtctggatggacatgctggagaaaaaggggatccaggactc
ccaggggatcatgaagatgcgattccaggtgataaaggatttcctggacctctgggtccc
ccgggcaaagcaggacctgtgggccccccgggactgggatttcctggtccaccaggagag
cgaggccacccaggagttccaggctgcccaggtgtgaggggccctgatggcttgaagggt
cagaaaggtgacacaatttcttgcaacgtaacctatcccgggaggcaaggccctccgggt
tttgatggacctccaggtccaaagggatttccaggtcccccaggtgcccctgggctgagc
ggttcagatgggcataaaggcagacctggcacaccaggaacatcggaaataccaggtccc
cctggtttccgtggtgacataggagatccgggttttggaggtgaaaaggggtcctcccct
gttgggcccccaggcccccctgggtcaccaggagtgaatggtcagaaaggaatcccggga
gaccctgcatttggtcacctgggacccccgggaaggaggggtctttcaggagtgccaggg
ataaaaggacccagaggtgatccgggatatccaggggctgaagggccagctggcattcct
ggattcccaggtctcaaaggtcccaaaggcagagagggacatgctgggtttccaggtgtc
ccaggtccacctggccattcctgtgaaagaggtgctccaggaataccagggcaaccggga
ctccctggggatccaggtagcccaggtgctccaggtgggaaaggacagccaggagatgtg
gggcctcctgggccagctggaatgaaaggtctccctggactcccaggacggcctggggca
catggtcccccgggcctcccaggaatcccgggtccctttggggatgatgggctacctggt
cctccaggtccaaaaggcccccgggggctgcctggtttcccaggttttcccggagaaaga
ggaaagcctggtgcagagggatgtcctggcacaaagggagaacccggagagaagggcacg
tctggctttcccggagaccagggagtgagaggggccaaaggagccataggacctcccgga
gatgaaggagaaatggctatcatttccaaaaagggaaaacccggggaacctggacctcct
ggagatgatggattcccaggagaaagaggtgataaaggaactcccgggatgcaagggaga
agaggagagccgggaagatatggaccaccaggatttcacagaggggaacctggtgagaaa
ggtcagccagggccttctggacacccaggccctccaggctcaactggtctaagagggttc
attggttttccaggacttccaggtgaccagggtgagccaggttctccaggtccccctgga
ttttcaggaatcgatggagcaacaggacctaaaggaaacaaaggtgaccctgccagtcac
tttggtccacctggtccaaagggtgagccaggtagctctggatgtccagggcattttgga
gcatctggagaccagggcttgcctggcgttcaagggcccagaggatcacccggaaggcca
ggaccacctggctcctctggaccaccagggtgcccaggtgatcaggggatgcctgggctg
aggggacagccaggagaaatgggagaccctgggccaagaggcctccagggggatccaggg
ataccaggtcctccaggaataaaaggtccctccggatcacctggcctgaacggcttacat
ggattgaagggtcagaaaggaaccaaaggtgcttcaggtttgcatgatgtggggccacct
ggtccagtgggaatgcctgggctaaaaggggagagaggagatcctgggagcccaggaatc
tctcctccaggtccttgtggagaaaaaggtctcccaggtcccccagggagatcaggacca
cctggtcctgcaggtgccacaggaagagcgcctaaggacattcctgacccgggtccatct
ggagatcagggacctcctggtcccgatggcccaagaggagcacctgggcctccaggcctc
cctgggagtgttgacctcctgagaggggagccaggtgactgtggtctaccagggccacca
ggtctccccggcccaccaggccctccaggatacaaaggctttccaggatgtgatggaaaa
gatggccagaaaggaccaatgggattcccagggccgcagggaccacatggatttcctggg
ccacctggagagaagggtttacctggacctccagggagaaaagggcccactggtcttcca
ggtcccagaggtgaaccggggccacttgcagatgcggatgactgtccccgaatcccaggg
cttcctggggtgccaggcctgagaggaccagaaggagccatgggactccctggaatgaga
ggccccccaggaccagggtgcaaaggagagcctgggctggacggcaggaggggcatggat
ggcattcctgggtctcctgggcctcccggacgtaaaggtgacacaggagaagacggctat
cccggaggaccagggcctcctggtcccactggggatcctgggcccaaagggtttggcgct
ggatacctcagtggcttcctactggttctccacagtcagacagaccaggagcccacctgc
cccctgggcatgcccaggctctggactgggtatagtctgttatacctggaaggacaagag
aaagctcacaatcaagaccttggtctggcagggtcttgccttcccgtgtttagcacgctg
ccctttgcctactgcaacatccaccaggtgtgccactatgcccagagaaacgacagatcc
tactggctggccagcgctgcacccctccccatgatgccactctctgaagaggcgatccgc
ccctatgtcagccgctgtgcggtatgcgaggccccggcccaggcggtggcggtgcacagc
caggaccagtccatccccccatgtccgcagacctggaggagcctctggattgggtattca
ttcctgatgcacacaggagctggggaccaaggaggagggcaggccctcatgtcacccggc
agctgcctggaagatttcagagcagcaccattccttgaatgccaaggccggcagggaact
tgccacttttttgcaaatgagtatagcttctggctgacaacagtgaaagcagacttgcag
ttttcccctgctccagcaccagacaccttaaaagaaagccaggcccaacgccagaaaatc
agccggtgccaggtctgtgtgaagtatagctag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539549
Entry
108539549         CDS       T04641                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta 3
  KO
K06244  laminin, beta 3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108539549 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108539549 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108539549 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108539549 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108539549 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108539549 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108539549 (LAMB3)
   05145 Toxoplasmosis
    108539549 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II Sec20 UPF0242 F5_F8_type_C Tropomyosin
Other DBs
NCBI-GeneID: 108539549
NCBI-ProteinID: XP_017743801
UniProt: A0A2K6M188
LinkDB
Position
Un
AA seq 1172 aa
MRPLFLLCFALPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQHG
EWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGNTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQFLPQRP
NARLNGGKVQLNLMDLASGIPATQSKKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTAVQVHDVCVCQHNTAGPNCEHCAPFYNNR
PWRPAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCQDHTEGKNCERCQL
HYFRNRRPGASIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDMPCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPHNSLSPQCNQFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAATGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRLG
SLRNATASLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSAAVTEQEVAQVASAILSLRR
ALQGLQPDLPLEEETLSLPRDLESLDRSFNGLLTMYQRKREQFEKLSSADPSGAFRMLTT
AYEQSAQAVQQVSDSSRLLDQLRDSRREAERLAQQAGGGGGTGSPQLVALRLEMSSLPDL
TPTFNKLCGSSRQMACTPGSCPGELCPHDNGTACGSHCRGVLPRAGGAFWMAGQVAEQLR
GFNAQLQQTRQMIRAAEESASQIQSNAQRLETQVSTSRSQMEEDVRRTRLLIQQVRDFLT
DPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARSRAHAVEGQVEDVVGNLQQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQ
VLQPAEKLVTSMTKQLGDFWTRMEELRRQAWQQRAQAVQAQQLAEGASEQALSAQEGFER
IKQKYAELKDRLGQSPTLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI
MLRSADLTGLEKRVEQIRDHINERVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgagaccactcttcctcttgtgttttgccttacctggcctcctgcatgcccagcaagcc
tgctcccgtggggcctgctatccacctgttggggacctgcttgttgggaggacccggttt
ctccgagcttcatctacatgtggactgaccaagcctgagacctactgcacccagcatggt
gagtggcagatgaaatgctgcaagtgtgactccaggcagcctcacaactactacagtcac
cgagtagagaatgtggcttcatcctccggccccatgcgctggtggcagtcacagaatgat
gtgaaccctgtctctctgcagctggacctggacaggagattccagcttcaggaagtcatg
atggagttccaggggcccatgcccgccggcatgctgattgagcgctcctcagacttcggt
aacacctggcgagtgtaccagtacctggctgctgactgcacctccaccttccctcgggtc
cgccagggccggcctcagagctggcaggatgttcggtgccagttcctgccccagaggcct
aatgcgcgcctaaatggggggaaggtccaacttaaccttatggatttagcatctgggatt
ccagcaactcaaagtaaaaaaattcaagagctgggggagatcacaaacttgagagtcaac
ttcaccaggctggccccggtgccccaaaggggctaccaccctcccagcgcctactatgcc
gtgtctcagctccgtctgcaggggagctgcttctgtcacggccatgctgatcgctgcgcc
cccaagcctggggcctctgctggcccctccaccgccgtgcaggtccatgatgtctgcgtc
tgccagcacaacactgccggcccaaattgtgaacactgtgcgcccttctacaacaaccgg
ccctggagacctgcagagggccaggacacccatgaatgccaaaggtgcgactgcaatggg
cactcagagacatgtcactttgaccccgctgtgtttgccgccagccagggggcatatgga
ggtgtgtgtgacaattgccaggaccacaccgaaggcaagaactgtgagcggtgtcagctg
cactatttccggaaccggcgcccgggagcttccattcaggagacctgcatcccctgcgag
tgtgatccggatggggcagtgccaggggctccctgtgacccagtgaccgggcagtgtgtg
tgcaaggagcatgtgcagggagagcgctgtgacctatgcaagccgggcttcactggactc
acctacgccaacccgcagggctgccaccgctgtgattgcaacatcctggggtcccggagg
gacatgccgtgtgacgaggagagtgggcgctgcctgtgtctgcccaacgtggtgggcccc
aagtgtgaccagtgcgctccctaccactggaagctggccagtggccagggctgtgaaccg
tgtgcctgcgacccacacaactccctcagcccccagtgcaaccagtttacagggcagtgc
ccctgtcgggaaggctttggtggcctgacatgcagcgctgcagccatccgccagtgtcca
gaccggacctatggagacgcagctacaggatgccgagcctgtgactgtgatttccgggga
acagagggcccaggctgcgacaaggcatcgggccgctgcctctgccgccctggcttgact
gggccccgctgtgaccagtgccagcgaggctactgcaaccgctacccggtgtgtgtggcc
tgccacccttgcttccagacctatgatgcagacctccgggagcaggccctgcgccttggt
agcctccgcaatgccaccgccagcctgtggtcagggccagggctggaggaccgtggcctg
gcctcccggatcctagatgcaaagagtaagattgagcagatccgagcagttctcagcagc
gccgcagtcacagagcaggaggtggctcaggtggccagtgccatcctctccctcaggcga
gctctccagggcctgcagccggatctgcccctagaggaggagacgttgtcccttccgaga
gacctggagagtctggacagaagcttcaatggtctcctcactatgtatcagaggaagagg
gagcagtttgaaaaactaagcagtgctgatccttcaggagccttccggatgctgaccaca
gcctacgagcagtcagcccaggctgttcagcaggtctccgacagctcgcgccttttggac
cagctcagggacagccggagagaggcagagaggctggcgcagcaggcgggaggaggagga
ggcaccggcagcccccagcttgtggccttgaggctggagatgtcttcgttacctgacctg
acacccaccttcaacaagctctgtggcagctccaggcagatggcttgcactccaggatca
tgccctggtgagctgtgtccccatgacaatggcacagcctgtggttcccactgcaggggt
gtccttcccagggccggtggggccttctggatggcagggcaggtggctgagcagctgcgg
ggcttcaatgcccagctccagcagaccaggcagatgattagggcagccgaggaatcagcc
tcgcagattcaatccaatgcccagcgcctggagacccaggtgagcaccagccgctcccag
atggaggaagatgtcagacgcacgcggctcctcatccagcaggtccgggatttcctaaca
gaccccgacactgatgcagccactatccaggaggtcagcgaggctgtgctggccctgtgg
ctgcccacagactcagctaccgttctacagaagatgaacgagatccaggccattgcagcc
aggctccccaacgtggacctggtgctgtcacagaccaagcaggacattgcgcgggcccgc
aggctgcaggctgaggctgaggaagccaggagccgagcccatgcagtggagggccaggtg
gaggatgtggttgggaacctgcagcagggcacagtggcactgcaggaagctcaggacacc
atgcaaggcaccagccgctctcttaggcttatccaggacagggttgctgaggttcagcag
gtactgcagccagcagaaaagctggtgacaagcatgaccaagcagctgggtgacttctgg
acacggatggaggagctccgccgccaagcctggcagcagcgggcacaggcagtccaggcc
cagcagcttgcagaaggtgccagcgagcaggcattgagtgcccaagagggatttgagaga
ataaaacaaaagtatgctgagttgaaggaccggttgggtcagagtcccacgttgggtgaa
cagggtgcccggatccagagtgtgaagacagaggcagaggagctatttggggagaccatg
gagatgatggacaggatgaaagacatggagttggagctgctgcggggcagccaggccatc
atgctgcgctcagcggacctgacaggactggagaagcgtgtggagcagatccgtgaccac
atcaatgagcgtgtgctctactatgccacctgcaagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540465
Entry
108540465         CDS       T04641                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta 1
  KO
K05636  laminin, beta 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108540465 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108540465 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108540465 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540465 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108540465 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108540465 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108540465 (LAMB1)
   05145 Toxoplasmosis
    108540465 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C CorA
Other DBs
NCBI-GeneID: 108540465
NCBI-ProteinID: XP_017745030
LinkDB
Position
Un
AA seq 1747 aa
MGLLQVLAFSFLALCGARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQRLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVKCNCNE
HSSSCHFDMAVYLATGNVSGGVCDDCQHNTMGHNCEQCKPFYYQHPERDIRDPNFCERCT
CDPAGSQNEGICDSYTDFSTGLIAGQCRCKLHVEGEHCDVCKEGFYDLSGEDPFGCKSCA
CNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALN
NSCSAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDR
IPSWTGAGFVRVPEGAYLEFFIDDIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPP
SSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYT
LIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNII
FSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCK
PCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPV
MGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVT
LQLACVCDPGYIGSRCDDCASGFFGNPSEVGGLCQPCQCHNNIDTTDPEACDKETGRCLK
CLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQAHCNGSDCQCDKATGQCLCLPN
VIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQE
LFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPC
HQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPA
AEPLKNIGNLFEESEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTV
KELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDV
MMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTD
EGEKKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALSEVEQLSKMVSEAKLRADEAKQSA
EDILLKTNATKEKMDKSNEDLRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQ
LQNLTEDIRERVESLSQVEVILQQSAADIARAEMLLEEAKKASKSATDVKVTADMVKEAL
EEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELK
RKAAQNSGEAEYIEKVVYTVKQSADDVKKTLDGELDEKYKKVENLIAKKTEESADARRKA
EMLQNEAKTLLAQANSKLQLLKDLERKYEDNQKYLEDKAQELARLEGEVRSLLKDISQKV
AVYSTCL
NT seq 5244 nt   +upstreamnt  +downstreamnt
atgggtcttctccaggtgttagctttcagtttcttagccctgtgcggagcccgagtgcgc
gctcaagaacccgagttcagctacggctgcgccgaaggcagttgctaccccgccaccggc
gaccttctcatcggccgagcacagaggctttcggtgacctcgacgtgcgggctgcacaag
cccgagccctactgtatcgtcagccacttgcaggaggacaaaaaatgcttcatatgcaat
tcccaagatccttatcatgagaccctgaatcctgacagccatctcattgaaaatgtggtc
actacatttgcgccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccagctgctatgctgatagaacgatcgtctgactttgggaaaacctgg
ggcgtgtacagatacttcgcctatgactgtgaggcctcgtttccaggcatttcaactggc
cccatgaaaaaagttgatgacataatttgtgattcccgatattctgacattgaaccctca
actgaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agcccaaggatacagaatttattaaaaattaccaacttgagaatcaagtttgtgaaactg
catactttgggagataaccttctggattccagaatggaaatcagagaaaagtattattat
gcagtttatgatatggtggttcgaggaaattgcttctgctatggtcatgccagcgaatgt
gcccctgtggatggattcaatgaagaagtggaaggaatggtaaaatgtaattgcaatgaa
cattccagctcatgtcactttgacatggctgtttacctggccacggggaacgtcagcgga
ggcgtgtgtgatgactgtcagcacaacacgatggggcacaactgtgagcagtgcaagccg
ttttactaccagcacccagagagggacatccgagatcctaatttctgtgaacgatgtaca
tgtgacccagctggctctcaaaatgagggaatttgtgacagctatactgatttttctact
ggtctcattgctggccagtgtcggtgtaaattacatgtggaaggagaacattgtgatgtt
tgcaaagaaggcttctatgatttaagtggtgaagatccatttggttgtaaatcttgtgct
tgcaatcctctgggaacgattcctggagggaatccttgtgattccgagacaggtcactgc
tactgcaagcgtctggtgacaggacagcattgtgaccagtgcctgccagagcactggggc
ttaagcaatgatttggatggatgtcgaccatgtgactgtgaccttgggggagcattaaac
aatagttgctctgcagagtcaggccagtgctcatgtcggcctcacatgattggacgtcag
tgcaatgaagtggaacctggttactactttgccaccctggatcactacctctatgaagcg
gaggaagccaacttggggcccggggttagcatagtggagcggcagtacatccaggaccgg
attccctcctggactggagccggctttgtccgagtgcctgaaggggcttatttggagttt
ttcattgatgacataccatattccatggagtatgacatcctaattcgctatgagccacag
ctacccgaccactgggaaaaagctgtcatcacagtgcagcgacctggaaagattccaccc
agcagccgatgtggtaataccatccccgatgatgacaaccaggtggtgtcattatcacca
ggctcaagatacgttgtccttcctcggccagtgtgctttgagaagggaacgaactacacg
gtgaggttggagctgcctcaatacacctcctctgatagcgacgtggagagcccctacacg
ctgatcgattctcttgttctcatgccatactgtaaatcactggacatcttcaccgtggga
ggttcaggagatggggtggtcaccaacagtgcctgggaaacctttcagagataccgatgt
ctagagaacagcagaagcgttgtgaaaacgccgatgacagatgtttgcagaaacatcatc
tttagcatttctgccctgttacaccagacaggcctggcttgtgaatgcgaccctcagggt
tcattgagttccgtgtgtgatcccaacggaggccagtgccagtgccggcccaacgtggtt
ggaagaacctgcaacagatgcgcacctggaacttttggctttggccccagtggatgcaaa
ccttgtgagtgccatctgcaaggatctgtcaatgccttctgcaatcctgtcactggccag
tgccactgtttccagggagtgtatgctcggcagtgtgatcggtgcttacctgggcactgg
ggatttccaagttgccagccctgccagtgcaatggccacgccgatgactgcgacccagtg
atgggggagtgcttgaactgccaggactacactatgggtcataactgtgagagatgcttg
gctggttactatggtgaccccatcattgggtcaggagatcattgccgcccttgcccttgc
ccagatggtcccgacagtggacgccagtttgccaggagctgctaccaagatcctgttact
ttacagcttgcctgtgtttgtgatcctggatacattggttccagatgtgacgactgtgcc
tcaggattctttggcaatccatcggaagttgggggcttgtgtcagccttgccagtgtcac
aacaacattgacacgacagacccagaagcctgtgacaaggagaccgggaggtgcctcaag
tgcctgtaccacacggaaggggaacactgtcagttctgccggtttggatactatggtgac
gccctccagcaggactgtcgaaagtgtgtctgtaattacctgggtaccgtgcaagcgcac
tgtaacggctctgactgccagtgtgacaaagccactggtcagtgcttgtgtcttcctaat
gtgatcgggcagaactgtgaccgctgtgcacctaatacctggcagctggccagtggcact
ggctgtgacccatgcaactgcaacgctgctcattccttcgggccatcttgcaatgagttc
acagggcagtgccagtgcatgcctgggtttggaggccgcacctgcagcgagtgccaggaa
ctcttctggggagaccctgacgtggagtgccgagcctgtgactgtgaccccaggggcatt
gagacgccacagtgtgaccagtccacgggccagtgtgtctgcgtggagggtgttgagggt
ccacgctgtgacaagtgcacgcgagggtactcgggggtcttccctgactgcacaccctgc
caccagtgctttgctctttgggacgtgatcattgctgagctgaccaacaggacacacaga
ttcctggagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgtgagact
gtggactcagtggagaggaaagtcagcgagataaaagacatcctggcgcagagccccgca
gcagagccactgaaaaacattgggaatctctttgaggaatcagagaaactgattaaagat
gttacagaaatgatggctcaagtagaagtgaaattatctgacacaacttcccaaagcaac
agcacagccaaagaactggattctctacagacagaagcggaaagcctagacaacactgtg
aaagaacttgctgaacaactggaatttatcaaaaactcagatattcggggtgccttggat
agcattaccaagtatttccagatgtctcttgaggcagaggagagggtgaatgcctccacc
acagaacccaacagtactgtggaacagtcagccctcatgagagacagagtagaagatgtg
atgatggagcgagaatcccagttcaaggaaaaacaagaggagcaggctcgcctccttgat
gaactggcaggcaagctgcaaagcctagacctttcagctgctgccgaaatgacctgtgga
acacccccaggggcctcctgttccgagactgaatgtggcgggccaaactgcagaactgat
gaaggagagaagaagtgtggggggcctggctgtggtggtctggttactgttgcacacaat
gcctggcagaaagccatggacttggaccaagatgtcctgagtgccctgtctgaagtggaa
cagctctccaagatggtctctgaagcaaaactgagggcagatgaggcaaaacagagtgct
gaagacattctgttgaagacaaatgctaccaaagaaaaaatggacaagagcaatgaggat
ctgagaaatctaatcaagcaaatcagaaactttttgacccaggatagtgctgatttggac
agcattgaagcagttgctaatgaagtactgaaaatggaaatgcctagcaccccacagcag
ttacagaacttgacagaagatatacgtgaacgagttgaaagcctttctcaagtagaggtt
attctacagcagagtgctgctgacattgccagagctgagatgttgttagaagaagctaaa
aaagcaagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagctctg
gaagaagcagaaaaggcccaggtcgcagcagagaaggcaattaaacaagcagatgaagac
attcaaggaactcagaacctgctaacttcgattgagtctgaaacagcagcttctgaggaa
accttgttcaacgcgtcccagcgcatcagcgagttagagaggaatgtggaagaacttaag
cggaaagctgcccaaaactctggggaggcagaatatattgaaaaagtagtatatactgtg
aagcaaagcgcagatgatgttaagaagactttagatggtgaacttgatgaaaaatataaa
aaagtagaaaacttaattgccaaaaaaactgaggagtcagctgatgccagaaggaaagct
gaaatgctacaaaatgaagcaaaaactcttttagctcaagcaaacagcaagctgcaactg
ctcaaagatttagaaagaaaatatgaagacaatcaaaaatacttagaagataaagctcaa
gaattagcaagactggaaggagaagtccgttcactccttaaggatataagccagaaagtt
gctgtttatagcacgtgcttgtaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540493
Entry
108540493         CDS       T04641                                 

Definition
(RefSeq) laminin subunit beta-4
  KO
K06245  laminin, beta 4
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb05145  Toxoplasmosis
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108540493
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108540493
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108540493
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540493
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108540493
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108540493
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108540493
   05145 Toxoplasmosis
    108540493
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 108540493
NCBI-ProteinID: XP_017745090
LinkDB
Position
Un
AA seq 1101 aa
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVIVSFEPEREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQNDSLDKYYYALDEMVVRGSCFCNGHASECRPMQKVRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNTCRSCSCNSHSSRCHFDMTMYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTVSGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLSLLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPA
PGYFFAPLNFYLYEAEEATPLQGLAPLGSETFGQSPAVHIVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTVQIVVNPPQGSEHCVPKTSQSKPQS
FALPAATRIMLLPTPICLEPDVQYSLDVYFSQPLEGESHTHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPLVVGRCCDRCSTGSYGLGHHGCHPCHCHPRGSKDTVCDLVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCRPCPCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCQPCPCNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCR
RCSCHASGVSPAECAPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLIHGRGCQSC
DCDPRTSQSSHCDQARYFKTY
NT seq 3306 nt   +upstreamnt  +downstreamnt
atgcaatttcaactgaccctttttttgcaccttgggtggctcagttactcaaaagctcaa
gatgactgcaacaggggtgcctgtcatcccaccaccggcgatctcctggtgggcaggaac
acacagcttacggcttcttctacctgtgggctgagcagagcccagaaatactgcatcctc
agttacctggagggcgaacaaaaatgcttcatctgtgactctagatttccatatgatcca
tacgcccaacccaacagccacaccattgagaatgtcattgtaagttttgaaccagagaga
gaaaagaaatggtggcagtctgaaaatggtcttgatcatgtcagcatcagactggactta
gaggcattatttcggttcagccaccttatcttgacctttaagacttttcggcctgctgca
atgttagttgaacgttccacagactatggacacacctggaaagtgttcaaatattttgca
aaagactgtgccacttcctttcctaacatcacatctggccaggcccagggagtgggagac
attgtttgtgactccaaatactcggatattgaaccctcaacaggtggagaggttgtttta
aaagttttggatccgagttttgaaattgaaaacccttatagcccctacatccaagacctt
gtgacattgacaaacctgaggataaactttaccaagctccacacccttggggatactttg
cttggaaggaggcaaaatgattcccttgataaatactactatgctctggacgagatggtt
gttcggggaagctgcttttgcaatggccatgctagcgaatgtcgccctatgcagaaggtg
cggggagatgttttcagccctcctggaatggttcacggtcagtgtgtctgtcagcacaat
acagatggtccaaactgtgagagatgcaaggacttcttccaggatgctccttggaggcca
gctgcagacctccaggacaacacttgcagatcgtgcagttgtaacagccactccagccgc
tgtcacttcgacatgactatgtacctggcaagcggtggcctcagcgggggcgtgtgtgaa
gactgccagcacaacactgaggggcagcactgcgaccgctgcaggcccctcttctacagg
gaccccctcaagaccatctcagatccctacgcatgcattccttgtgaatgtgaccctgat
gggaccgtatctggtggtatttgtgtgagccactctgatcctgccttagggtctgtggcc
ggccagtgcctttgtaaagagaacgtggaaggagccaaatgcgaccagtgcaagcccaac
cactatggactgagcgccactgaccccttgggctgccagccctgcgactgtaaccccctt
gggagtctgtcactcttgacctgtgatgtggatacaggccaatgcttgtgcctgtcatat
gtcaccggagcacactgcgaagaatgcactgttggatactggggcctgggaaatcatctc
catgggtgttctccctgtgactgtgatattggaggtgcttattctaacgtgtgttcaccc
aagaatgggcagtgtgaatgccgcccacatgtcactggccgtagctgctctgaaccagcc
cctggctacttctttgctcctttgaatttctatctctatgaggcggaggaagccacgcca
ctccaaggactggcgcctttgggctcggagacttttggccagagtcctgctgttcacatt
gttttaggagagccagttcctgggaaccctgttacatggactggacctggatttgccagg
gttctccctggggctggcttgagatttgctgtcaacaacattccctttcctgtggacttc
accattgccattcgctatgaaacccagtctgcagctgactggactgtccagatcgtggtg
aacccccctcaagggagtgagcactgcgtacccaagacttcacagtcaaagcctcagtct
tttgccttaccagcggctaccagaatcatgctgcttcccacacccatctgtttagaacca
gatgtacaatattccttagacgtctatttttctcagcctttggaaggagagtcccacact
cattcacacgtcctggtggactcccttggccttattccccaaatcaattcattggagaat
ttctgcagcaagcaggacttagatgagtatcagcttcacaactgtgttgaaattgcctca
gcaatgggacctcaagtgctcccgggtgcctgtgaaaggctgatcatcagcatgtccgcc
aagctgcatgatggggctgtggcctgcaagtgtcacccccagggctcagtcggatccagc
tgcagccgacttggaggccagtgccagtgtaaacctcttgtggtcgggcgctgctgtgat
aggtgctcaaccggaagctatggtttggggcatcatggctgtcacccatgtcactgccat
cctcgaggatcaaaggacactgtgtgtgacctagtaacagggcagtgcccctgccatgga
gaggtatctggccgccgctgtgatcgctgcctggcaggctactttggatttcccagctgc
cgcccttgcccttgtaatgggtttgctgaactttgtgatcctgagacggggtcatgcttc
aattgtggaggctttacaactggcagaaactgtgaaaggtgtattgatggttactatgga
aatccttcttcaggacagccctgtcgtccttgcctgtgtccagatgatccctcaagcaat
cagtattttgcccattcctgttatcagaatctgtggagctcagatgtaatctgcaattgt
cttcaaggttatacgggtactcagtgtggagaatgctctactggtttctatggaaatcca
agaatttcaggagcaccttgccaaccatgtccctgcaacaacaatatagatgtaaccgat
ccagagtcctgcagccgggtaacaggggagtgccttcgatgtttgcacaacactcagggt
gcaaactgccagctctgcaaaccaggtcactatggatcagccctaaatcagacctgcaga
agatgctcctgccatgcttctggcgtgagtcccgcggagtgtgcccctggtgggggagct
tgcctctgtgaccctgtcactggtgcatgcccttgtctgccgaatgtcacaggcctggcc
tgtgatcgttgtgctgatggatactggaatctgattcatggcagaggatgtcagtcatgt
gactgtgaccctaggacctctcaaagtagccactgtgaccaggcaagatactttaaaact
tactag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543178
Entry
108543178         CDS       T04641                                 

Gene name
FN1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04810  Regulation of actin cytoskeleton
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05100  Bacterial invasion of epithelial cells
rbb05135  Yersinia infection
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108543178 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108543178 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108543178 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108543178 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108543178 (FN1)
   05205 Proteoglycans in cancer
    108543178 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108543178 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108543178 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108543178 (FN1)
   05100 Bacterial invasion of epithelial cells
    108543178 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108543178 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108543178 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108543178 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108543178 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108543178 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:rbb04990]
    108543178 (FN1)
Membrane trafficking [BR:rbb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    108543178 (FN1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   108543178 (FN1)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108543178 (FN1)
Domain-containing proteins not elsewhere classified [BR:rbb04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   108543178 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 108543178
NCBI-ProteinID: XP_017748989
LinkDB
Position
Un
AA seq 2478 aa
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVRAAVYQPQPHP
QPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPTSRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGKERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHYSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSSPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITHPGYDTGNGIQLPGTSGQQPTVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGLGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCHCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTVSALAP
RVCFLILDSPFYRHLSSE
NT seq 7437 nt   +upstreamnt  +downstreamnt
atgctcaggggtccggggcccgggctgctgctgctggccgtcttgtgcctggggacagcg
gtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctgggcaatgccttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactggaaacacttaccgagtgggtgacacttacgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgcaccatagcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacacgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaaatgttttgatcatgctgctgggacttcctatgtggtcggagaaacc
tgggagaagccctaccaaggctggatgatggtagattgtacttgcctaggagaaggcagc
ggacgcatcacttgcacctctagaaatagatgcaatgatcaggacacgaggacgtcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgagaggcacaccactgtgcagaccacatcg
agcggatctggccccttcaccgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctgccccctatggccactgtgtcacagacagtggtgtgatctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcatgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacatacggtggcaactcaaatggggagccatgt
gtcttaccattcacctacaacggcaggacgttctactcctgcaccacagaagggcgacag
gacggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatattctttc
tgcacggaccatactgttttggttcagactcgaggaggaaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcaggaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttggattc
tgccccatggctgcccatgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggccacatgatgaggtgcacgtgtgttggg
aacggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaatgacacattccacaagcgtcatgaagagggacacatg
ctgaactgtacatgcttcggtcagggtcggggcagatggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacattttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgagactccg
agtcagcccaactctcaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggaggcctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccgagaagtgactcgctttgacttcaccaccact
agcaccagcacacctgtgaccagcaacactgtgacaggagagacaactcccctttctccc
cttgtggccacttctgaatctgtcactgaaatcacagccagcagctttgtggtctcctgg
gtctcagcttctgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtatctggatcttccaagcacagccacttccgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcccgatgcccctcctgaccctactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaagctcccatcacaggg
tacagaatagtctattcaccatcagtagaaggcagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgacttgcaacctggcgtccagtataatatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgttcagatacagtgccctctcccagggatctgcagtttgtggaagtgacagac
gtgaaggtcaccatcatgtggacaccgcctgagagtgcggtgaccggctaccgcgtggat
gtgatccccgtcaacctgcctggggagcacgggcagaggctgcccaccagcaggaacacc
ttcgcagaagtcaccgggttgtcccctggggtcacctattacttcaaagtctttgccgtg
aaccacgggagggagagcaagcctctgactgccgaacagacaaccaaactggacgctccc
actaacctccagtttgtcaatgaaacggattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgactgtgggcctgacccgaagaggccaacccagg
cagtacaatgtgggtccctctgtctcgaagtacccactgaggaatctgcagcctggatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
gtctttaccacactgcagcctgggagctccattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacacctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatcgttgtg
tctggcttgactccaggagtggaatatgtctacaccatccaagtcctgagagacggaaag
gaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaacaaacttg
catctggagacaaaccctgacactggagtgctcacagtctcctgggagaggagtaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggatattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggt
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttgaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctacgaacaacacgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggcattgacttttctgatatt
accgccaactcttttactgtgcactggattgctcctcgagccaccatcactggctacagg
atccgccatcaccccgagcactatagcgggagacctcgagaagatcgggtgcccccctct
cggaattccatcaccctcaccaacctcactccaggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccgagggacctggaagttgttgctgcgacccccaccagcttgctgatcagctgggat
gctcctgctgtcaccgtgagatattacaggatcacttacggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagtggccttaaa
cctggagtcgattataccatcactgtgtatgctgtcactggccgtggagacagccccgca
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcacagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctatgctcagaatccaagtggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaggtcacaccaacgagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatcgagtgcgggtgacccccaaggagaagaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccagctcagggagttgtcacc
actctagagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagaccgagacgatcactggcttccaagttgatgctgtt
ccagccaatggccagactccaatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccttgaacgacaat
gcccggagctcccctgtggtcatcgacgcctccactgccattgatgcaccatccaaccta
cgtttcctggccaccacacccaattccttgctggtatcgtggcagccgccacgtgccagg
atcaccggctacatcatcaagtatgagaagcctgggtcttctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaactgaatat
acaatttatgtcattgccctgaagaataaccagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcatcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccactgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacacctcccacaacagccacccccata
aggcataggccaagaccatacccgccgaatgtaggtgaggagattcaaattggtcacatc
cccagggaagacgtagactatcacctctacccacatgggctgggactcaatccaaatgcc
tctacaggacaagaagctctctctcagacaaccatctcatgggccccattccaggacact
tctgagtacatcatttcatgtcatcctgttggcactgacgaagagcccttacagttcagg
gttcctggaacttccaccagtgctactctgacaggcctcaccagaggtgccacctacaac
atcatagtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttacc
gtgggcaactccgtcaatgaaggcttgaaccaacctaccgatgactcatgctttgacccc
tacacggtttcccattacgccgttggagatgagtgggaacgaatgtctgaatcaggcttt
aaactgttgtgccactgcttaggctttggaagtggtcatttcagatgtgattcatctaga
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaa
aatggccagatgatgagctgcacgtgtcttgggaacggaaaaggagaattcaagtgtgac
cctcatgaggcaacgtgttatgatgatgggaagacgtatcacgtaggggaacagtggcag
aaggaatatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctgggggtgaacccagtcccgaaggcactactggtcagtcc
tacaaccagtattctcagagataccatcagagaacaaacactgtaagtgcattagcgcca
cgagtgtgtttcctcatactagacagtcctttctacaggcatctttcttcagaatga

DBGET integrated database retrieval system