KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512087
Entry
108512087         CDS       T04641                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb04270  Vascular smooth muscle contraction
rbb04370  VEGF signaling pathway
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108512087 (MAP2K2)
   04012 ErbB signaling pathway
    108512087 (MAP2K2)
   04014 Ras signaling pathway
    108512087 (MAP2K2)
   04015 Rap1 signaling pathway
    108512087 (MAP2K2)
   04370 VEGF signaling pathway
    108512087 (MAP2K2)
   04371 Apelin signaling pathway
    108512087 (MAP2K2)
   04066 HIF-1 signaling pathway
    108512087 (MAP2K2)
   04068 FoxO signaling pathway
    108512087 (MAP2K2)
   04072 Phospholipase D signaling pathway
    108512087 (MAP2K2)
   04071 Sphingolipid signaling pathway
    108512087 (MAP2K2)
   04024 cAMP signaling pathway
    108512087 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    108512087 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    108512087 (MAP2K2)
   04150 mTOR signaling pathway
    108512087 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108512087 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    108512087 (MAP2K2)
   04218 Cellular senescence
    108512087 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108512087 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    108512087 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108512087 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108512087 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    108512087 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    108512087 (MAP2K2)
   04660 T cell receptor signaling pathway
    108512087 (MAP2K2)
   04662 B cell receptor signaling pathway
    108512087 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    108512087 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108512087 (MAP2K2)
   04929 GnRH secretion
    108512087 (MAP2K2)
   04912 GnRH signaling pathway
    108512087 (MAP2K2)
   04915 Estrogen signaling pathway
    108512087 (MAP2K2)
   04917 Prolactin signaling pathway
    108512087 (MAP2K2)
   04921 Oxytocin signaling pathway
    108512087 (MAP2K2)
   04926 Relaxin signaling pathway
    108512087 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    108512087 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    108512087 (MAP2K2)
   04916 Melanogenesis
    108512087 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108512087 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    108512087 (MAP2K2)
   04730 Long-term depression
    108512087 (MAP2K2)
   04722 Neurotrophin signaling pathway
    108512087 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108512087 (MAP2K2)
   05206 MicroRNAs in cancer
    108512087 (MAP2K2)
   05205 Proteoglycans in cancer
    108512087 (MAP2K2)
   05230 Central carbon metabolism in cancer
    108512087 (MAP2K2)
   05231 Choline metabolism in cancer
    108512087 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108512087 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108512087 (MAP2K2)
   05225 Hepatocellular carcinoma
    108512087 (MAP2K2)
   05226 Gastric cancer
    108512087 (MAP2K2)
   05214 Glioma
    108512087 (MAP2K2)
   05216 Thyroid cancer
    108512087 (MAP2K2)
   05221 Acute myeloid leukemia
    108512087 (MAP2K2)
   05220 Chronic myeloid leukemia
    108512087 (MAP2K2)
   05218 Melanoma
    108512087 (MAP2K2)
   05211 Renal cell carcinoma
    108512087 (MAP2K2)
   05219 Bladder cancer
    108512087 (MAP2K2)
   05215 Prostate cancer
    108512087 (MAP2K2)
   05213 Endometrial cancer
    108512087 (MAP2K2)
   05224 Breast cancer
    108512087 (MAP2K2)
   05223 Non-small cell lung cancer
    108512087 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108512087 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    108512087 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108512087 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108512087 (MAP2K2)
   05135 Yersinia infection
    108512087 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108512087 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    108512087 (MAP2K2)
   05161 Hepatitis B
    108512087 (MAP2K2)
   05160 Hepatitis C
    108512087 (MAP2K2)
   05164 Influenza A
    108512087 (MAP2K2)
   05163 Human cytomegalovirus infection
    108512087 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108512087 (MAP2K2)
   05165 Human papillomavirus infection
    108512087 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108512087 (MAP2K2)
   01522 Endocrine resistance
    108512087 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108512087 (MAP2K2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     108512087 (MAP2K2)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: STE group
  STE7 family
   108512087 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CAMSAP_CC1
Other DBs
NCBI-GeneID: 108512087
NCBI-ProteinID: XP_017702642
LinkDB
Position
Un
AA seq 405 aa
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMVSASRTEAGAGPPWNRACWGEGRLPLTAPF
LRGSSAPAPRRCHTGVYIDALVLFCFLFVFFERQSDSVAPPGFQLPSSPLWALSFLPLLQ
PERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVVDGEEGEPRSIS
PRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPA
ERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAM
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccctaccatcgccgag
ggcccgtcccctaccagcgagggcgcctccgaggcaaacctggtggacctgcagaagaag
ctggaggagctggaactggacgagcagcagaagaagcgtctggaagcctttctgacccag
aaagccaaggtcggcgaactcaaagacgatgacttcgaaaggatctcagagctgggcgcg
ggcaacggcggggtggtcaccaaagtccagcacagaccctcgggcctcatcatggccagg
aagctgatccaccttgagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtcctgcatgagtgcaactcgccatacatcgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggagcacatggtgagtgcgtccaggacagaggcaggggca
gggcctccctggaatagagcatgttggggagaaggaaggctccccctcacggcccctttc
ctcagaggcagcagtgcgccggctcccaggagatgccatacaggtgtgtatatagatgct
ttggttttgttttgttttctttttgtgttttttgagaggcagtctgactctgtcgcccct
cccgggttccagctgccatcgtcgcccctctgggctctttccttcctgcctctgctgcag
ccggagcgattgcagggcacacattactcggtgcagtcggacatctggagcatgggcctg
tccctggtggagctggccatcggaaggtaccccatccccccgcccgacgccaaggagctg
gaggccatctttggccggccagtggtcgacggggaagaaggagagcctcgcagcatctcg
cctcggccgagaccccccgggcgccccatcagcggtcacgggatggacagccggcccgcc
atggccatcttcgaattgctggactatattgtgaatgagccgcctcccaagctgcccaac
ggtgtgttcacccccgacttccaggagtttgtcaataaatgcctcatcaagaacccagca
gagcgggcggacctgaagatgctcacgaaccacaccttcatcaagcggtccgaggtggaa
gaagtggattttgctgggtggttgtgtaaaaccctgcgactgaaccagcccggcacaccc
acgcgtaccgccatgtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514672
Entry
108514672         CDS       T04641                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04114  Oocyte meiosis
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb04270  Vascular smooth muscle contraction
rbb04370  VEGF signaling pathway
rbb04371  Apelin signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04540  Gap junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05034  Alcoholism
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108514672 (MAP2K1)
   04012 ErbB signaling pathway
    108514672 (MAP2K1)
   04014 Ras signaling pathway
    108514672 (MAP2K1)
   04015 Rap1 signaling pathway
    108514672 (MAP2K1)
   04370 VEGF signaling pathway
    108514672 (MAP2K1)
   04371 Apelin signaling pathway
    108514672 (MAP2K1)
   04668 TNF signaling pathway
    108514672 (MAP2K1)
   04066 HIF-1 signaling pathway
    108514672 (MAP2K1)
   04068 FoxO signaling pathway
    108514672 (MAP2K1)
   04072 Phospholipase D signaling pathway
    108514672 (MAP2K1)
   04071 Sphingolipid signaling pathway
    108514672 (MAP2K1)
   04024 cAMP signaling pathway
    108514672 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    108514672 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    108514672 (MAP2K1)
   04150 mTOR signaling pathway
    108514672 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108514672 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108514672 (MAP2K1)
   04210 Apoptosis
    108514672 (MAP2K1)
   04218 Cellular senescence
    108514672 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108514672 (MAP2K1)
   04540 Gap junction
    108514672 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    108514672 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108514672 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108514672 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    108514672 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    108514672 (MAP2K1)
   04660 T cell receptor signaling pathway
    108514672 (MAP2K1)
   04662 B cell receptor signaling pathway
    108514672 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    108514672 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    108514672 (MAP2K1)
   04062 Chemokine signaling pathway
    108514672 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108514672 (MAP2K1)
   04929 GnRH secretion
    108514672 (MAP2K1)
   04912 GnRH signaling pathway
    108514672 (MAP2K1)
   04915 Estrogen signaling pathway
    108514672 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    108514672 (MAP2K1)
   04917 Prolactin signaling pathway
    108514672 (MAP2K1)
   04921 Oxytocin signaling pathway
    108514672 (MAP2K1)
   04926 Relaxin signaling pathway
    108514672 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    108514672 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    108514672 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    108514672 (MAP2K1)
   04916 Melanogenesis
    108514672 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108514672 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    108514672 (MAP2K1)
   04726 Serotonergic synapse
    108514672 (MAP2K1)
   04720 Long-term potentiation
    108514672 (MAP2K1)
   04730 Long-term depression
    108514672 (MAP2K1)
   04722 Neurotrophin signaling pathway
    108514672 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108514672 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514672 (MAP2K1)
   05206 MicroRNAs in cancer
    108514672 (MAP2K1)
   05205 Proteoglycans in cancer
    108514672 (MAP2K1)
   05230 Central carbon metabolism in cancer
    108514672 (MAP2K1)
   05231 Choline metabolism in cancer
    108514672 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108514672 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108514672 (MAP2K1)
   05212 Pancreatic cancer
    108514672 (MAP2K1)
   05225 Hepatocellular carcinoma
    108514672 (MAP2K1)
   05226 Gastric cancer
    108514672 (MAP2K1)
   05214 Glioma
    108514672 (MAP2K1)
   05216 Thyroid cancer
    108514672 (MAP2K1)
   05221 Acute myeloid leukemia
    108514672 (MAP2K1)
   05220 Chronic myeloid leukemia
    108514672 (MAP2K1)
   05218 Melanoma
    108514672 (MAP2K1)
   05211 Renal cell carcinoma
    108514672 (MAP2K1)
   05219 Bladder cancer
    108514672 (MAP2K1)
   05215 Prostate cancer
    108514672 (MAP2K1)
   05213 Endometrial cancer
    108514672 (MAP2K1)
   05224 Breast cancer
    108514672 (MAP2K1)
   05223 Non-small cell lung cancer
    108514672 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108514672 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    108514672 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    108514672 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108514672 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108514672 (MAP2K1)
   05135 Yersinia infection
    108514672 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108514672 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    108514672 (MAP2K1)
   05161 Hepatitis B
    108514672 (MAP2K1)
   05160 Hepatitis C
    108514672 (MAP2K1)
   05164 Influenza A
    108514672 (MAP2K1)
   05163 Human cytomegalovirus infection
    108514672 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108514672 (MAP2K1)
   05165 Human papillomavirus infection
    108514672 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108514672 (MAP2K1)
   01522 Endocrine resistance
    108514672 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108514672 (MAP2K1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     108514672 (MAP2K1)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: STE group
  STE7 family
   108514672 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 108514672
NCBI-ProteinID: XP_017706555
UniProt: A0A2K6KU99
LinkDB
Position
Un
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLHQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctctgcggagaccaacttggaggccttgcagaagaagctggaggagcta
gagcttgatgagcagcagcgaaagcgccttgaggcctttctcacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggggccggcaatggcggt
gtggtgttcaaggtctcccacaagccttctggcctggtcatggccagaaagctaattcat
ctggagatcaaacccgcaatccggaaccagatcataagggagctgcaggttctgcatgag
tgcaactctccatacatcgtgggcttctatggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatggaggttctctggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatatctg
agggagaagcacaagatcatgcacagagatgtcaagccctccaacatcctagtcaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tctgtgcagtcagacatctggagcatgggactctctctggtagagatggcggttgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagaccccacccaggccaaggacccccgggaggccccttagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccaaaattgcccagtggagttttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttcaccagcccagcacaccaacccatgctgctggcgtctaa

DBGET integrated database retrieval system