KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512199Help
Entry
108512199         CDS       T04641                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00010  Glycolysis / Gluconeogenesis
rbb00053  Ascorbate and aldarate metabolism
rbb00071  Fatty acid degradation
rbb00280  Valine, leucine and isoleucine degradation
rbb00310  Lysine degradation
rbb00330  Arginine and proline metabolism
rbb00340  Histidine metabolism
rbb00380  Tryptophan metabolism
rbb00410  beta-Alanine metabolism
rbb00561  Glycerolipid metabolism
rbb00620  Pyruvate metabolism
rbb01100  Metabolic pathways
Module
rbb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108512199 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    108512199 (ALDH2)
   00620 Pyruvate metabolism
    108512199 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108512199 (ALDH2)
   00561 Glycerolipid metabolism
    108512199 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108512199 (ALDH2)
   00310 Lysine degradation
    108512199 (ALDH2)
   00330 Arginine and proline metabolism
    108512199 (ALDH2)
   00340 Histidine metabolism
    108512199 (ALDH2)
   00380 Tryptophan metabolism
    108512199 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108512199 (ALDH2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108512199 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108512199
NCBI-ProteinID: XP_017702833
UniProt: A0A2K6KLE4
LinkDB All DBs
Position
Un
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGLRLLSAAATQAVPAPNQQPEVFCNKIFINNEWHNAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTITIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgctgccgcccgcttcgggccccgcctgggcctccgcctcttgtcagctgcc
gccacccaggccgtgcccgcccccaaccagcagcccgaggtcttctgcaacaagatcttc
ataaacaatgaatggcacaatgccgtcagcaggaaaacattccccacggtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccaactgggctcaccttggcgtcgcatggacgcatcacac
aggggccggctgctgaaccgcctggctgatctgatcgagcgggaccggacctacctggcg
gccttggagactctggacaatggcaaaccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
attcccattgacggagacttcttcagctacacccgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacgcccctcactgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggtcaacatcgttcctgga
tttggccccacggccggggccgccatcgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagattggccgcctcattcaggttgctgccgggagcagcaatctcaag
agagtgaccctggagctaggggggaagagccccaacatcatcatgtcagatgccgacatg
gactgggccgtggagcaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gctggctcccggaccttcgtgcaggaggacatctatgacgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacactgggaaacaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
accgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaagttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcaccgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggcggctacaagatgtcgggcagtggccgggagctgggcgagtacggcctgcag
gcatacactgaagtgaaaactatcacaatcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system