KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512239
Entry
108512239         CDS       T04641                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05143  African trypanosomiasis
rbb05144  Malaria
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108512239 (MYD88)
   04064 NF-kappa B signaling pathway
    108512239 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108512239 (MYD88)
   04621 NOD-like receptor signaling pathway
    108512239 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108512239 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108512239 (MYD88)
   05135 Yersinia infection
    108512239 (MYD88)
   05133 Pertussis
    108512239 (MYD88)
   05134 Legionellosis
    108512239 (MYD88)
   05152 Tuberculosis
    108512239 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108512239 (MYD88)
   05161 Hepatitis B
    108512239 (MYD88)
   05171 Coronavirus disease - COVID-19
    108512239 (MYD88)
   05164 Influenza A
    108512239 (MYD88)
   05162 Measles
    108512239 (MYD88)
   05168 Herpes simplex virus 1 infection
    108512239 (MYD88)
   05169 Epstein-Barr virus infection
    108512239 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    108512239 (MYD88)
   05145 Toxoplasmosis
    108512239 (MYD88)
   05140 Leishmaniasis
    108512239 (MYD88)
   05142 Chagas disease
    108512239 (MYD88)
   05143 African trypanosomiasis
    108512239 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 108512239
NCBI-ProteinID: XP_017702895
UniProt: A0A2K6KGE5
LinkDB
Position
Un
AA seq 309 aa
MRPDRAEAPGQPAMAAGGPGAESAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY
LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWT
RLAKALSLP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgcgacccgaccgcgccgaggctccaggacagcccgccatggctgcaggaggtcccggc
gctgagtctgcggccccggtctcctccacatcctcccttcccctggctgctctcaacatg
cgagtgcggcgccgcctatctctgttcttgaacgtgcggacacaggtggcggccgactgg
accgcgctggcagaggagatggactttgagtacttggagatccggcaactggagacgcac
gccgaccccactggcaggctgctggacgcctggcagggacgccctggcgcctcggtaggc
cgactgctggagctgcttaccaagctgggccgcgacgacgtgctgctggagctgggaccc
agcattgaggaagattgccaaaagtatatcttgaagcagcagcaggaggaggctgagaag
cctttacaggtggccgctgtagacagcagtgtcccacggacagcagaactggcgggcatc
accacacttgacgaccccctggggcatatgcctgagcgtttcgatgccttcatctgctat
tgccccagcgacatccagtttgtgcaggagatgatccggcaactggaacagacaaactat
cgactgaagttgtgtgtgtctgaccgtgatgtcctgcctggcacctgtgtctggtccatt
gctagtgaactcatcgaaaagaggtgccgccggatggtggtggttgtctctgatgattac
ctgcagagcaaggaatgtgacttccagaccaaatttgcactcagcctctctccaggtgcc
catcagaagcgactgatccccatcaagtacaaggcaatgaagaaagagttccccagcatc
ctgaggttcatcactgtctgcgattacaccaacccctgcaccaaatcttggttctggact
cgccttgccaaggccttgtccctgccctga

DBGET integrated database retrieval system