KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512296
Entry
108512296         CDS       T04641                                 

Gene name
VHL
Definition
(RefSeq) von Hippel-Lindau tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108512296 (VHL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108512296 (VHL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108512296 (VHL)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108512296 (VHL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108512296 (VHL)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     108512296 (VHL)
SSDB
Motif
Pfam: VHL VHL_C Arm_vescicular
Other DBs
NCBI-GeneID: 108512296
NCBI-ProteinID: XP_017702998
UniProt: A0A2K6LB50
LinkDB
Position
Un
AA seq 213 aa
MPRRAENWDEAEAGAEEAGAEEYGPEEDGREESGAEESGPEGSGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVRPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQEHIANQRMGD
NT seq 642 nt   +upstreamnt  +downstreamnt
atgccccggagggcggagaactgggacgaggctgaggcaggcgcggaggaggcaggcgcc
gaagagtacggccctgaagaggacggccgggaggagtcgggcgccgaggagtccggcccg
gaagggtccggcccggaggaactgggcgccgaggaggagatggaggcagggcggccgcgg
cccgttctgcgctcggtgaactcgcgtgagccctcccaggtcatcttctgcaaccgcagc
ccgcgcgtggtgctgcccgtatggctcaacttcgacggcgagccgcagccgtacccaacg
ctgccgcctggcacgggtcgccgcatccacagctaccgaggtcacctttggctcttcaga
gatgcagggacacacgatggacttctggttaaccaaactgaattatttgtgccatctctc
aatgttgacggacagcctatttttgccaatatcacactgccagtgtatactctgaaagaa
cgatgcctccaggttgtccggagcctagtcaggcctgagaattataggagactggacatt
gtcaggtcgctctacgaagatctggaagaccacccaaatgtgcagaaagacctggagcga
ctgacgcaggagcacattgcaaatcaacggatgggagattga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515508
Entry
108515508         CDS       T04641                                 

Gene name
VHLL
Definition
(RefSeq) von Hippel-Lindau tumor suppressor like
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04120  Ubiquitin mediated proteolysis
rbb05200  Pathways in cancer
rbb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108515508 (VHLL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108515508 (VHLL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108515508 (VHLL)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108515508 (VHLL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rbb04121]
    108515508 (VHLL)
Ubiquitin system [BR:rbb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     108515508 (VHLL)
SSDB
Motif
Pfam: VHL_C VHL
Other DBs
NCBI-GeneID: 108515508
NCBI-ProteinID: XP_017707913
LinkDB
Position
Un
AA seq 210 aa
MWFECQLARVVKASEARPWSAGNGVELEAKAGTQEAGPEEYCQEESGAEEEMAAGAAWPV
LRSINSPELSLVICNRSPRIVLPVWLNCYEELLPGRDFCIHNFRSHPWLFRDARTHNKLM
VNQTELFTPCSNVDGQPVFANITLPAYTLKERCLQVFRSLVKPENDMRLDIVRSLCDDLE
DQPNVLKDLERLTQEHSENLWMAGHGGSLL
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtggtttgagtgtcaattggcccgagttgtcaaggcttcggaggcaaggccctggagt
gcggggaacggggtggagttagaggccaaggcgggcacccaagaggcaggcccagaagag
tactgccaggaagagtcgggcgccgaggaggagatggcggctggagcagcatggcctgtg
ctgcgctccataaactcgcctgagctctccctggtcatttgcaaccgcagcccacgcatc
gtgctgcctgtgtggctcaactgctatgaagagctgctgcctggcagggacttctgcatc
cacaatttccgaagccacccatggctcttcagggatgcaaggacacacaataaacttatg
gttaaccaaactgaattgtttacgccatgttccaatgttgatggacagcctgtttttgcc
aacatcacactgccagcatataccctaaaagagcgatgcctccaggttttccgaagccta
gtcaagcccgagaatgacatgagactggacatcgtcagatcactctgtgacgatctggaa
gaccagccaaatgtattgaaagacctggagcggctgacgcaggagcacagtgaaaatctg
tggatggctgggcatggtggctcactcctgtaa

DBGET integrated database retrieval system