KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512486
Entry
108512486         CDS       T04641                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04012  ErbB signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04114  Oocyte meiosis
rbb04217  Necroptosis
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04934  Cushing syndrome
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05152  Tuberculosis
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05214  Glioma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108512486 (CAMK2D)
   04310 Wnt signaling pathway
    108512486 (CAMK2D)
   04066 HIF-1 signaling pathway
    108512486 (CAMK2D)
   04020 Calcium signaling pathway
    108512486 (CAMK2D)
   04024 cAMP signaling pathway
    108512486 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108512486 (CAMK2D)
   04217 Necroptosis
    108512486 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108512486 (CAMK2D)
   04922 Glucagon signaling pathway
    108512486 (CAMK2D)
   04912 GnRH signaling pathway
    108512486 (CAMK2D)
   04921 Oxytocin signaling pathway
    108512486 (CAMK2D)
   04916 Melanogenesis
    108512486 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    108512486 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108512486 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    108512486 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    108512486 (CAMK2D)
   04728 Dopaminergic synapse
    108512486 (CAMK2D)
   04720 Long-term potentiation
    108512486 (CAMK2D)
   04722 Neurotrophin signaling pathway
    108512486 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    108512486 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    108512486 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    108512486 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108512486 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108512486 (CAMK2D)
   05205 Proteoglycans in cancer
    108512486 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    108512486 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108512486 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    108512486 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    108512486 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108512486 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108512486 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108512486 (CAMK2D)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108512486 (CAMK2D)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108512486 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 108512486
NCBI-ProteinID: XP_017703253
UniProt: A0A2K6KB53
LinkDB
Position
Un
AA seq 533 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatctgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtagcaagagaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggccggagcttatgattttccatcaccggaatgggacacg
gtaactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
atcacagcctcggaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaagaaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaatattcctaccccggcgctggagccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagagattatcaaagtcactgaacaactgatcgaagctatcaacaacggggacttt
gaagcctacacaaaaatctgtgacccaggccttactgcttttgaacctgaagctctgggt
aatttagtggaagggatggattttcaccgattctacttcgaaaatgctttgtccaaaagc
aataaaccaatccacactattattctaaaccctcatgtacatctggtaggggatgatgcc
gcctgcatagcatatattaggctcacacagtacatggatggcagtggaatgccaaagaca
atgcagtcagaagagactcgtgtgtggcaccgtcgggatggaaagtggcagaatgttcat
tttcatcgctcggggtcaccaacagtacccatcaagccaccctgtattccaaatgggaaa
gaaaacttctcaggaggcacctctttgtggcaaaacatctaa

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108516884
Entry
108516884         CDS       T04641                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04012  ErbB signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04114  Oocyte meiosis
rbb04217  Necroptosis
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04934  Cushing syndrome
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05152  Tuberculosis
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05214  Glioma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108516884 (CAMK2G)
   04310 Wnt signaling pathway
    108516884 (CAMK2G)
   04066 HIF-1 signaling pathway
    108516884 (CAMK2G)
   04020 Calcium signaling pathway
    108516884 (CAMK2G)
   04024 cAMP signaling pathway
    108516884 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108516884 (CAMK2G)
   04217 Necroptosis
    108516884 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108516884 (CAMK2G)
   04922 Glucagon signaling pathway
    108516884 (CAMK2G)
   04912 GnRH signaling pathway
    108516884 (CAMK2G)
   04921 Oxytocin signaling pathway
    108516884 (CAMK2G)
   04916 Melanogenesis
    108516884 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    108516884 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108516884 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    108516884 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    108516884 (CAMK2G)
   04728 Dopaminergic synapse
    108516884 (CAMK2G)
   04720 Long-term potentiation
    108516884 (CAMK2G)
   04722 Neurotrophin signaling pathway
    108516884 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    108516884 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    108516884 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    108516884 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108516884 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108516884 (CAMK2G)
   05205 Proteoglycans in cancer
    108516884 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    108516884 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108516884 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    108516884 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    108516884 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108516884 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108516884 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108516884 (CAMK2G)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108516884 (CAMK2G)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108516884 (CAMK2G)
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal SnoaL_2 Kdo
Other DBs
NCBI-GeneID: 108516884
NCBI-ProteinID: XP_017710074
LinkDB
Position
Un
AA seq 506 aa
MSTSETSKHRVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENL
LLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGV
ILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRIT
ADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQSSA
PASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQ
TAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSA
GMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGM
DFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEET
RVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtcgacttctgaaacatccaaacatcgtgttactggcggggagctgtttgaagacatt
gtggccagagagtactacagtgaagcagatgccagccactgtatacatcagattctggag
agtgttaaccacattcaccagcatgacatcgtccacagggacctgaagcctgagaacctg
ctgctggcgagtaaatgcaagggtgccgctgtcaagctggctgattttggcctagccatc
gaagtacagggagagcagcaggcttggtttggttttgctggaaccccaggttacttgtcc
cctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgcggggtc
atcctgtatatcctcctggtgggctatcctcccttctgggatgaggatcagcacaagctg
tatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacggtaact
cctgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgcatcacg
gctgaccaggctctcaagcacccgtgggtctgtcaacgatccacggtggcatccatgatg
catcgtcaggagactgtggagtgtttgcgcaagttcaacgcccggagaaaactgaagggt
gccatcctcacaaccatgcttgtctccaggaacttctcagttggcaggcagagctccgcc
cccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagcctgttg
aacaagaagtcggatggcggtgtcaagaaaaggaagtcgagttccagcgtgcacctaatg
ccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagcccgcgcccttgcag
acggccatggagccacaaaccactgtggtacacaacgctacagatgggatcaagggctcc
acagagagctgcaacaccaccacagaagatgaggacctcaaagctgccccgctccgcact
gggaatggcagctcggtgcctgaaggacggagctcccgggacagaacagccccctctgca
ggcatgcagccccagccttctctctgctcctcagccatgagaaaacaggagatcattaag
attacagaacagctaattgaagccatcaacaatggggactttgaggcctacacgaagatt
tgtgatccaggcctcacttcctttgagcctgaggcccttggtaacctcgtggaggggatg
gatttccataagttttactttgagaatctcctgtccaagaacagcaagcctatccatacc
accatcctaaacccacacgtccacgtgattggggaggacgcagcgtgcatcgcctacatc
cgcctcacccagtacatcgacgggcagggtcggcctcgcaccagccagtcagaagagacc
cgggtctggcaccgtcgggatggcaagtggctcaatgtccactatcactgctcaggggcc
cctgccgcaccgctgcagtga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108529387
Entry
108529387         CDS       T04641                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04012  ErbB signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04114  Oocyte meiosis
rbb04217  Necroptosis
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04934  Cushing syndrome
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05152  Tuberculosis
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05214  Glioma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108529387
   04310 Wnt signaling pathway
    108529387
   04066 HIF-1 signaling pathway
    108529387
   04020 Calcium signaling pathway
    108529387
   04024 cAMP signaling pathway
    108529387
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108529387
   04217 Necroptosis
    108529387
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108529387
   04922 Glucagon signaling pathway
    108529387
   04912 GnRH signaling pathway
    108529387
   04921 Oxytocin signaling pathway
    108529387
   04916 Melanogenesis
    108529387
   04925 Aldosterone synthesis and secretion
    108529387
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108529387
  09154 Digestive system
   04971 Gastric acid secretion
    108529387
  09156 Nervous system
   04725 Cholinergic synapse
    108529387
   04728 Dopaminergic synapse
    108529387
   04720 Long-term potentiation
    108529387
   04722 Neurotrophin signaling pathway
    108529387
  09157 Sensory system
   04740 Olfactory transduction
    108529387
   04750 Inflammatory mediator regulation of TRP channels
    108529387
  09158 Development and regeneration
   04360 Axon guidance
    108529387
  09159 Environmental adaptation
   04713 Circadian entrainment
    108529387
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108529387
   05205 Proteoglycans in cancer
    108529387
  09162 Cancer: specific types
   05214 Glioma
    108529387
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108529387
   05022 Pathways of neurodegeneration - multiple diseases
    108529387
  09165 Substance dependence
   05031 Amphetamine addiction
    108529387
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108529387
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108529387
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108529387
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108529387
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108529387
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 108529387
NCBI-ProteinID: XP_017727178
LinkDB
Position
Un
AA seq 340 aa
MCILVPVTSLQPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLR
KEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKN
LINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTT
MLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGI
KESSDSANTTIEDEDAKAPRVPDILSSVRRGSGAPEAEGPLPCPSPAPFSPLPAPSPRIS
DILNSVRRGSGTPEAEGPLSAGPLPCLSPALLGPLPSLCK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtgcatccttgtgccggtcacctccctgcagccggagaacctgctcctggccagcaag
tgcaaaggggctgctgtgaagctggcagacttcggcctggctatcgaggtgcagggggac
cagcaggcgtggtttgggttcgctggcacaccaggctacctgtcccctgaggtccttcgc
aaagaggcgtatggcaagcccgtggacatctgggcatgtggggtgatcctgtacatcctg
ctcgtgggctacccacccttctgggacgaggaccagcacaagctgtaccagcagatcaag
gccggcgcctacgacttcccgtcccccgagtgggacaccgtcactcctgaagccaaaaac
ctaatcaaccagatgctgaccatcaaccctgccaagcgcatcacagcccatgaggccctg
aagcacccgtgggtctgccaacgttccacggtagcctccatgatgcacagacaggagact
gtggagtgtctgaaaaagttcaatgccaggagaaagctcaagggagccatcctcaccacc
atgctggccacacggaatttctcagcagccaagagtttactcaacaagaaagcagatgga
gtcaagccccagacgaatagcaccaaaaacagtgcagccgccaccagccccaaagggacg
cttcctcctgccgccctggagcctcaaaccaccgtcatccataacccagtggacgggatt
aaggagtcttctgacagtgccaacaccaccatagaggatgaagacgctaaagcccccagg
gtccctgacatcctgagctcagtgaggaggggctcgggagccccagaagccgaggggccc
ctgccctgcccatctccagctccctttagccccctgccagccccatcccccaggatctct
gacatcctgaactctgtgagaaggggctcaggaaccccagaagccgagggccccctctca
gcggggcccctaccctgcctgtctccggctctcctaggccccctaccctccctgtgtaag
tag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532044
Entry
108532044         CDS       T04641                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04012  ErbB signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04114  Oocyte meiosis
rbb04217  Necroptosis
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04934  Cushing syndrome
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05152  Tuberculosis
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05214  Glioma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108532044 (CAMK2A)
   04310 Wnt signaling pathway
    108532044 (CAMK2A)
   04066 HIF-1 signaling pathway
    108532044 (CAMK2A)
   04020 Calcium signaling pathway
    108532044 (CAMK2A)
   04024 cAMP signaling pathway
    108532044 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108532044 (CAMK2A)
   04217 Necroptosis
    108532044 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108532044 (CAMK2A)
   04922 Glucagon signaling pathway
    108532044 (CAMK2A)
   04912 GnRH signaling pathway
    108532044 (CAMK2A)
   04921 Oxytocin signaling pathway
    108532044 (CAMK2A)
   04916 Melanogenesis
    108532044 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    108532044 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108532044 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    108532044 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    108532044 (CAMK2A)
   04728 Dopaminergic synapse
    108532044 (CAMK2A)
   04720 Long-term potentiation
    108532044 (CAMK2A)
   04722 Neurotrophin signaling pathway
    108532044 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    108532044 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    108532044 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    108532044 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108532044 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532044 (CAMK2A)
   05205 Proteoglycans in cancer
    108532044 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    108532044 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108532044 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    108532044 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    108532044 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108532044 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108532044 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108532044 (CAMK2A)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108532044 (CAMK2A)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108532044 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 108532044
NCBI-ProteinID: XP_017731265
UniProt: A0A2K6MEY7
LinkDB
Position
Un
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagctttctccgtggtacgaaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccgactccatgacagcatctca
gaggaaggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccattctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggcgcctatgatttcccatcaccagaatgggacaccgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcatcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctctggagggaagagtggggga
aacaagaagagtgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacagccttcgaacctgaggccctggggaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgccggcggcatcccacgcaccgcccagtcg
gaggagacccgtgtctggcaccgccgggacggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108544005
Entry
108544005         CDS       T04641                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04012  ErbB signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04114  Oocyte meiosis
rbb04217  Necroptosis
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04916  Melanogenesis
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04925  Aldosterone synthesis and secretion
rbb04934  Cushing syndrome
rbb04971  Gastric acid secretion
rbb05012  Parkinson disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05031  Amphetamine addiction
rbb05152  Tuberculosis
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05214  Glioma
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108544005
   04310 Wnt signaling pathway
    108544005
   04066 HIF-1 signaling pathway
    108544005
   04020 Calcium signaling pathway
    108544005
   04024 cAMP signaling pathway
    108544005
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108544005
   04217 Necroptosis
    108544005
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108544005
   04922 Glucagon signaling pathway
    108544005
   04912 GnRH signaling pathway
    108544005
   04921 Oxytocin signaling pathway
    108544005
   04916 Melanogenesis
    108544005
   04925 Aldosterone synthesis and secretion
    108544005
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108544005
  09154 Digestive system
   04971 Gastric acid secretion
    108544005
  09156 Nervous system
   04725 Cholinergic synapse
    108544005
   04728 Dopaminergic synapse
    108544005
   04720 Long-term potentiation
    108544005
   04722 Neurotrophin signaling pathway
    108544005
  09157 Sensory system
   04740 Olfactory transduction
    108544005
   04750 Inflammatory mediator regulation of TRP channels
    108544005
  09158 Development and regeneration
   04360 Axon guidance
    108544005
  09159 Environmental adaptation
   04713 Circadian entrainment
    108544005
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108544005
   05205 Proteoglycans in cancer
    108544005
  09162 Cancer: specific types
   05214 Glioma
    108544005
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108544005
   05022 Pathways of neurodegeneration - multiple diseases
    108544005
  09165 Substance dependence
   05031 Amphetamine addiction
    108544005
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108544005
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108544005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108544005
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108544005
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108544005
SSDB
Motif
Pfam: CaMKII_AD DUF4440 SnoaL_3 SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 108544005
NCBI-ProteinID: XP_017750380
LinkDB
Position
Un
AA seq 263 aa
MPVGAPGSWRRLETGLSWGDGTAPHLLRASLDAGATLASGPWACSWGKSGVRERGGVRCS
ETQAHHSPYLLPPHAAAKSLLNKKADGVKPQTNSTXNSAAATSPKGTLPPAALESSDSAN
TTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFH
RFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVW
HRRDGKWQNVHFHCSGAPVAPLQ
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcctgtaggagccccagggtcatggaggaggctggagacagggctgtcctggggtgac
gggacggccccccacctgctcagagccagcttggatgctggagccacacttgcctcagga
ccctgggcttgctcctggggaaagagtggggtcagggaaaggggtggggtgcgctgcagc
gagacccaggcccatcactcaccataccttcttcctccccatgcagcagccaagagttta
ctcaacaagaaagcagatggagtcaagccccagacgaatagcaccnaaaacagtgcagcc
gccaccagccccaaagggacgcttcctcctgccgccctggagtcttctgacagtgccaac
accaccatagaggatgaagacgctaaagcccggaagcaagagatcattaagaccacggag
cagctcatcgaggcggtcaacaacggtgactttgaggcctacgcgaaaatctgtgaccca
ggactgacctcatttgagcctgaagcactgggcaacctggttgaagggatggacttccac
agattctacttcgagaacctgctggccaagaacagcaagccgatccacacgaccatcctg
aacccgcacgtgcacgtcatcggagaggacgccgcctgcattgcttacatccggctcacg
cagtacattgacgggcagggccggccccgcaccagccagtctgaggagacccgtgtgtgg
caccgccgcgacggcaagtggcagaacgtgcacttccactgctcgggcgcgcctgtggcc
ccgctgcagtga

DBGET integrated database retrieval system