KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512516
Entry
108512516         CDS       T04641                                 

Gene name
BECN2
Definition
(RefSeq) beclin 2
  KO
K08334  beclin
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04215  Apoptosis - multiple species
rbb04371  Apelin signaling pathway
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108512516 (BECN2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108512516 (BECN2)
   04136 Autophagy - other
    108512516 (BECN2)
   04137 Mitophagy - animal
    108512516 (BECN2)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108512516 (BECN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108512516 (BECN2)
   05014 Amyotrophic lateral sclerosis
    108512516 (BECN2)
   05016 Huntington disease
    108512516 (BECN2)
   05017 Spinocerebellar ataxia
    108512516 (BECN2)
   05022 Pathways of neurodegeneration - multiple diseases
    108512516 (BECN2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108512516 (BECN2)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    108512516 (BECN2)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108512516 (BECN2)
SSDB
Motif
Pfam: APG6 APG6_N GAS BH3 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 108512516
NCBI-ProteinID: XP_017703268
LinkDB
Position
Un
AA seq 432 aa
MSSIRFLCHRCHQALRLSCSSESGSLPAAPALTSGQAEPADTREPGATTREVTDVEEQQD
GASSRPLPGDGSVSKDHANIFTLLGDLGPMQTLSSIQKAAGDIFDIVSGQEDVDHPLCEE
CTDSLLEQLDIQLALTEAESQNYQRCLETGMLATSEDETTAALRAELRDLELEEARLVQE
LEDVDRNNARAATDLEAAQAEAAELDQQERQYYRDYSALKWQQLELLDQLGNVENQLQYA
RVQMDRLKEINCFTATFEIWVEGSLGVINKFRLGCLPTVPVGWNEINAAWGQAALLLLAL
ANTIGLQFQRYRLMPCGDHSYLKPLTDDRTELQLFCYGGQDVFLNNKFDRAMVAFLDCMQ
QFKEEAEKGELGLCLPYRIQVETGLMEDADGRGECYSIRTHLNTQELWTKALKFLLINLK
WSLIWVASRYQK
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcttccatccgcttcctgtgccaccgctgccaccaggctctaaggctgagctgctcc
tcggagtccgggagcctccctgcagccccggcgctcacctctgggcaggctgagcccgca
gacacccgggagcccggcgccaccaccagggaggtgacagatgttgaggaacaacaggac
ggcgcctctagcagaccccttccaggtgatggcagtgtgtccaaggaccatgccaacatc
ttcaccctgctgggggaccttggccccatgcaaacgctcagtagcatccaaaaggcagct
ggggacatttttgacatcgtctctggccaagaagatgtggaccatcccctgtgtgaagag
tgcaccgacagtcttctagagcagctggacatccagctcgctctcacagaagctgagagt
cagaactaccaacgctgcctggagaccgggatgctggcgaccagcgaggacgagacgacg
gcggcgctgcgggcggagctgcgggacctggagctggaggaggccaggctggtgcaggag
ctggaggatgtggacaggaacaatgcaagagcagccacggatcttgaggcagcccaggca
gaggctgcggagctggatcagcaggagaggcagtactacagggactacagtgccttgaag
tggcagcagctggaactgcttgaccagctggggaacgtggagaaccagctgcaatatgcc
agggtccagatggaccggttgaaggaaatcaactgtttcactgccacgtttgagatctgg
gtggagggctccttgggcgtcatcaataaattcaggttgggctgcctccccactgtccct
gtgggctggaatgagattaacgctgcctggggacaggcggctttgctgctccttgccctg
gccaatacaattggactgcagtttcagaggtatcgactcatgccctgcggagaccattcc
tatctgaagcctttaacagatgaccgcactgagctccagttgttctgttatggggggcag
gatgttttcctcaataacaagttcgaccgcgcgatggtggccttcctggactgcatgcag
cagttcaaggaagaggctgagaagggtgagctgggcctctgtctgccctacaggatccag
gtggagacaggcctgatggaggacgctgatggccgaggggagtgctattccatcagaacc
catctgaacacgcaggagctgtggacaaaggcactcaagttcttgcttataaatttaaag
tggagtctcatctgggttgcctcaaggtatcaaaagtag

KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526772
Entry
108526772         CDS       T04641                                 

Gene name
BECN1
Definition
(RefSeq) beclin 1
  KO
K08334  beclin
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04136  Autophagy - other
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04215  Apoptosis - multiple species
rbb04371  Apelin signaling pathway
rbb05010  Alzheimer disease
rbb05014  Amyotrophic lateral sclerosis
rbb05016  Huntington disease
rbb05017  Spinocerebellar ataxia
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108526772 (BECN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108526772 (BECN1)
   04136 Autophagy - other
    108526772 (BECN1)
   04137 Mitophagy - animal
    108526772 (BECN1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    108526772 (BECN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108526772 (BECN1)
   05014 Amyotrophic lateral sclerosis
    108526772 (BECN1)
   05016 Huntington disease
    108526772 (BECN1)
   05017 Spinocerebellar ataxia
    108526772 (BECN1)
   05022 Pathways of neurodegeneration - multiple diseases
    108526772 (BECN1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108526772 (BECN1)
Membrane trafficking [BR:rbb04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    108526772 (BECN1)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108526772 (BECN1)
SSDB
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 FPP ERM Exonuc_VII_L NAPRTase_C
Other DBs
NCBI-GeneID: 108526772
NCBI-ProteinID: XP_017723140
UniProt: A0A2K6LCG0
LinkDB
Position
Un
AA seq 450 aa
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggaagggtctaagacgtccaacaacagcaccatgcaggtgagcttcgtgtgccagcgc
tgcagccagcccctgaaactggacacgagtttcaagatcctggaccgtgtcaccatccag
gaactcacagctccattacttaccacagcccaggcgaaaccaggagagacccaggaggaa
gagactaactcaggagaggagccatttattgaaactcctcgccaggatggtgtctctcgc
agattcatccccccagccaggatgatgtccacagaaagtgccaacagcttcactctgatt
ggggaggcatctgatggcggcaccatggagaacctcagccgaagactgaaggtcactgga
gacctttttgacatcatgtcgggccagacagatgtggatcacccactctgtgaggaatgc
acagatactcttttagaccagctggacactcagctcaacgtcactgaaaatgagtgtcag
aactacaaacgctgtttggagatcttagagcaaatgaatgaggatgacagtgaacagcta
cagatggagctaaaggagctagcactagaggaggagaggttgatccaggagctggaagac
gtggaaaagaaccgcaagatagtggcagaaaatctcgagaaggtccaggctgaggctgag
agactggatcaggaggaagctcagtatcagagagaatacagtgaatttaaacggcaacag
ctagagctggatgatgagctgaagagtgtggaaaaccagatgcgttatgcacagattcag
ctggataagctgaagaaaaccaatgtctttaatgcaaccttccacatctggcacagtgga
cagtttggcacaatcaataacttcaggctgggtcgcctgcccagtgttcccgtagaatgg
aatgagattaatgctgcttggggccagactgtgttgctgctccatgctctggccaataag
atgggtctgaaatttcagagatatcgacttgttccttacggaaaccattcgtatctggag
tctctgacagacaaatctaaggagctgccgttatactgttctggggggttgcggtttttc
tgggacaacaagtttgaccatgcaatggtggctttcctggactgtgtgcagcagttcaaa
gaagaggttgagaaaggcgagacacgtttttgtcttccctacaggatggatgtggaaaaa
ggcaagattgaagacacaggaggcagcggtggctcctattccatcaaaacccagtttaac
tctgaggagcagtggacaaaagctctcaagttcatgctgacgaatcttaagtggggtctt
gcgtgggtatcctcacaattttataacaaatga

DBGET integrated database retrieval system