KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108512687
Entry
108512687         CDS       T04641                                 

Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04020  Calcium signaling pathway
rbb04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108512687
   04020 Calcium signaling pathway
    108512687
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108512687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108512687
Ion channels [BR:rbb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108512687
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 108512687
NCBI-ProteinID: XP_017703534
LinkDB
Position
Un
AA seq 2302 aa
MNVEAGSQGQWRNCHGPSGYYEWGVMGSGGAAMVQMDIFEYMILATIIANCIVLALEQHL
PEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGI
LATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAI
LMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQF
DNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSG
EFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRR
ATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHM
VKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGP
RLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNL
VVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQ
ILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQEL
TKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRR
HHMSVWEQRTSQLRKHMQMSSQEALNREEAPPMNPLNPLNPLSPLNPLNTHPSLYRRPRA
IEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNC
DPTQQEAGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAM
PPEGEKDPELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEANAPLVLPHPE
LEVGKDMVPTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCITANTDKATTESTSVTV
AIPDVDPLVDSTVVHISNKTDGEASPLKEAEIREDEEEVENKKQKKEKRETGKAMVPHSS
MFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYV
FTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIK
TIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFK
GKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGE
GWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDK
MMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNT
VVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIG
SITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCL
LIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSC
LGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRD
SSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVL
MNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLD
LLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQVKVNASMLNKLCACIIHVN
CIFPIAISIVIGIVFFSFPLLPRKCPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSG
RSAYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGIYLPSDTQE
HAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRR
RSYHSSLRLSAHRLNSDSGHKSDSHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADW
ESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLS
YSSLIRHAGSISPPADGSEEGSPLTSQALESNNACLTESSNSLHPQQSQHASPQRYISEP
YLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGP
GPGMMCGAVNNLLSDTEEDDKC
NT seq 6909 nt   +upstreamnt  +downstreamnt
atgaacgtggaagcagggagccaggggcagtggaggaactgccatggtccaagtggatat
tatgaatggggagtcatgggcagtggaggagctgccatggtccaaatggatatttttgag
tacatgatcctggccaccatcattgccaactgcatcgtcctggccctggagcagcatctt
cctgaggacgacaagacccccatgtcccgaagactggaaaagacagaaccttatttcatt
gggatcttttgctttgaagctgggatcaaaattgtggccctggggttcatcttccataag
ggctcatacctccgcaatggctggaatgtcatggacttcatcgtggtcctcagtggcatc
ctggccactgcgggaacccacttcaacactcatgtggacctgaggaccctccgggctgtg
cgtgtcctgcggcccttgaagctcgtgtcagggatacctagcctgcagattgttttgaag
tccatcatgaaggccatggtacctcttctgcagattggccttctactcttctttgccatc
ctgatgtttgctattattggcttggagttctacagtgggaagttacatcgagcatgcttc
atgaacaattcaggtattctagaaggatttgacccccctcacccatgtggcgtgcagggc
tgcccagctggttatgaatgcaaggactggatcggccccaatgatgggatcacccagttt
gataacatcctttttgctgtgctgactgtcttccagtgcatcaccatggaagggtggacc
accgtgttgtacaacaccaatgatgccttaggagccacctggaattggctgtacttcatc
cccctcatcatcattggatccttctttgttctcaacctagtcctgggagtgctttccggg
gagtttgccaaagagagagagagagtggagaaccgaagggctttcatgaaactgcgacgc
cagcagcagattgagcgtgagctgaatggctaccgtgcctggatagacaaagcagaggaa
gtcatgctcgctgaagaaaataaaaatgctggaacatctgccttagaagtgcttcgaagg
gcaaccatcaagaggagccggacagaggccatgacccgagactccagcgatgagcactgt
gttgatatctcctctgtgggcacacctctggcccgagccagtatcaaaagtgcaaaggta
gacggggtctcttatttccggcacaaggaaaggcttctgcgcatctccattcgccacatg
gttaaatcccaagtgttttactggattgtgctgagccttgtagcactcaacactgcctgt
gtggccattgtccatcacaaccagccccagtggctcacccacctcctctactatgcagaa
tttctgtttctgggactcttcctcttggagatgtccctgaagatgtatggcatggggcct
cgcctttattttcactcttcattcaactgctttgattttggggtcacagtgggcagtatc
tttgaagtggtctgggcaatcttcagacctggtacgtcttttggaatcagtgtcttgcga
gccctccggcttctaagaatatttaaaataaccaagtattgggcttccctgcggaatttg
gtggtctccttgatgagctcaatgaagtctatcatcagtttacttttcctcctcttcctc
ttcatcgttgtctttgctctcctaggaatgcagttatttggtggcaggtttaactttaat
gatgggactccttcggcaaattttgacaccttccctgcagccatcatgactgtgttccag
atcctgacgggtgaggactggaatgaggtgatgtacaatgggatccgctcccagggcggg
gtcagctcaggcatgtggtccgccatctacttcattgtgctcaccttgtttggcaactac
acgctactgaatgtgttcttggctatcgctgtagataatctggccaacgcccaggagctg
accaaggatgaacaggaggaagaagaggccttcaaccagaaacatgcactgcagaaggcc
aaggaggtcagcccgatgtctgcacccaacatgccttcgatcgaaagagacagaaggaga
agacaccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccgg
caccacatgtctgtgtgggagcagcgcaccagccagctgaggaagcacatgcagatgtcc
agccaggaggccctcaacagggaggaggcgccgcccatgaacccactcaaccccctcaac
ccactcagccccctcaacccactcaacacacaccccagcctttatcggagacccagggcc
atcgagggcctggccctgggcctggccctggagaagttcgaggaggagcgcatcagccgt
ggggggtccctcaagggggatggaggggaccgatccagtgccctggacaaccagaggacc
cccttgtccctgggccagcgggagccgccgtggctggccaggccctgtcatgggaactgt
gacccgactcagcaggaggcggggggaggagaggctgtggtgacctttgaggaccgggcc
aggcacaggcagagccagcggcgcagccggcatcgccgcgtcaggacggaaggcaaggag
tcctcctcagcctctcggagcaggtctgctagccaggaacgcagtctggatgaagccatg
ccccctgaaggggagaaggatcctgagctcaggggcaaccatggtgccaaggagccaacg
atccaagaagagagagcccaggatttaaggaggaccaacagtctgatggtgtccagaggc
tccgggctggcaggaggccttgatgaggccaatgcccccttagtcctgccccatcctgag
ctggaagtggggaaggacatggtgccgacggagcaggagccagaaggtagcagtgagcag
gccctgctgggggatgtgcagctagacatgggccgggtcatcagccagagtgagcccgac
ctctcctgcatcacggccaacacggacaaggccaccaccgagagcaccagcgtcactgtc
gccatccccgacgtggaccccttggtggactcaaccgtggtgcacattagcaacaagacg
gatggggaagccagtcccttgaaggaggcagagatcagagaggatgaggaggaggtggag
aataagaagcagaagaaggagaagcgcgagacaggcaaagccatggtgccccacagctca
atgttcatcttcagcaccaccaacccgatccggagggcctgccactacatcgtgaacctg
cgctactttgagatgtgcatcctcctggtgattgcagccagcagcatcgccctggcagca
gaggaccccgtcctgaccaactcagagcgcaacaaagtcctgaggtattttgactatgtg
ttcacgggcgtgttcacctttgagatggttataaagatgatagaccaaggcttgatcctg
caggacgggtcctacttccgagacctgtggaacatcctggactttgtggtggtcgttggt
gcattggtggcctttgctctggcgaacgctttgggaaccaacaaaggacgggacatcaag
accatcaagtctctgcgggtgctccgagttctcaggccactgaaaaccatcaagcgcttg
cccaagctcaaggctgtctttgactgcgtggtgacctccttgaagaatgtcttcaacata
ctcattgtctacaagctcttcatgttcatctttgctgtcatcgcagttcagctcttcaag
ggaaagttcttttattgcacggacagttccaaggacacagagaaggagtgcataggcaac
tatgtagatcatgagaaaaacaagatggaggtgaagggccgggaatggaagcgccatgaa
ttccactacgacaacattatctgggccctgctgaccctcttcaccgtctccacgggggaa
ggatggcctcaagttctgcagcactctgtagatgtgacagaggaagaccgaggcccaagc
cgcagcaaccgcatggagatgtctattttttatgtggtctactttgtggtcttccctttc
ttcttcgtcaatatctttgtggctctcatcatcatcaccttccaggagcaaggggataag
atgatggaggagtgcagcctggagaagaatgagagggcgtgcatcgacttcgccatcagc
gccaaacctctcacccgctacatgccgcagaacaggcacaccttccagtaccgcgtgtgg
cactttgtggtgtctccgtccttcgaatacaccattatggccatgatcgccttgaatacc
gtcgtgctgatgatgaagtattactctgctccctgtacctatgagctggccctgaagtac
ctgaatatcgccttcaccatggtgttttccctggaatgcgtcctgaaggtcatcgctttt
ggctttttgaactatttccgagacacctggaatatctttgacttcatcaccgtgattggc
agtataacagaaattatcctgacagacagcaagctggtgaacaccagtggcttcaatatg
agctttctgaagctcttccgagctgcccgcctcataaagcttctgcgtcagggctatacc
atacgcattttgctgtggacctttgtgcagtcttttaaggccctcccttacgtctgcctt
ttaattgccatgcttttcttcatttatgccatcattgggatgcaggtatttggaaacata
aaattagatgaggagagtcacatcaaccggcacaacaacttccggagtttctttgggtcc
ctaatgctactcttcaggagtgccacaggtgaggcctggcaggagattatgctgtcatgc
ctcggggagaagggctgtgagcctgacaccaccgcaccctcagggcagaacgagaacgag
cgctgcggcaccgatctggcctacgtgtactttgtctccttcatcttcttctgctccttc
ttgatgctcaacctgttcgtggccgtcatcatggacaactttgagtacctgactcgggac
tcctccatcctggggcctcaccacttggacgaatttgtccgcgtctgggcagaatatgac
cgagcagcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtca
cctccgctaggcctcggcaagagatgtccctccaaagtggcatataagaggttggtcctg
atgaacatgccagtagctgaggacatgacggtccacttcacctccacacttatggctttg
atccggacagctctggacattaaaattgccaaaggtggtgcagacaggcagcagctagac
tcagagctacaaaaggagaccctagccatctggcctcacctatcccagaagatgctggat
ctgcttgtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatg
atgatcatggactactataagcagagtaaggtgaagaagcagaggcagcagctggaggaa
caggtgaaggtcaatgccagcatgctaaataagttatgtgcctgtattatccatgtaaat
tgtattttccccatagcaatctccatagtcattggaattgttttcttctccttccctctt
ttacccagaaaatgccccatgttccaacgcatggagccctcatctctgcctcaggagatc
attgctaatgccaaagccctgccttacctccagcaggaccccgtttcaggcctgagtggc
cggagtgcatacccttcgatgagtccactctctccccaggagatattccagttggcttgt
atggaccccgccgatgatggacagttccaggaacagcagtctctggagccagaggttagt
gaattaaaaagcgtgcagccctctaaccatggcatctaccttccttcggacacccaggag
catgcgggatctgggagggcatcctctatgccacgtctgactgtggatccccaggtggtg
acagaccccagctccatgagacgttcattttccactattcgggataagcgttcaaattcc
tcgtggttggaggaattctccatggagcgaagcagtgaaaatacctacaagtcccgtcgc
cggagttaccactcctccttgcggctgtcagcccaccgcctgaactctgattcaggccac
aagtccgacagtcaccgctcagggggcagggagcgaggacgatcaaaagagcgaaagcat
cttctctctcctgatgtctcccgctgcaattcagaagagcgagggacccaggctgactgg
gagtccccagagcgccgtcaatccaggtcacccagtgagggcaggtcacagacgcccaac
agacagggcacaggttccctaagtgagagctccatcccctctgtctctgacaccagcacc
ccaagaagaagtcgtcggcagctcccgcccgtcccaccaaagccccggcccctcctttcc
tacagctccctgattcgacacgcaggcagcatctctccacctgctgatggaagcgaggag
ggctccccgctgacctcccaagccctggagagcaacaacgcttgcctgaccgagtcttcc
aactccctgcacccccagcagagccaacatgcctccccgcagcgctacatctccgagccc
tacttggccctgcacgaagactcccacgcctcagactgtggcgaggaggagacgctcact
tttgaagcagccgtggctactagcctgggccgttccaacaccattggctcggccccacct
ctgcggcacagctggcagatgcccaatgggcactatcggcgacggaggcgcggggggcct
gggccaggcatgatgtgtggggctgtcaacaacctgctaagtgacacggaagaagacgac
aaatgctag

DBGET integrated database retrieval system